KEGG   Candidatus Nitrosopumilus sediminis: NSED_06005Help
Entry
NSED_06005        CDS       T02303                                 

Definition
(GenBank) hypothetical protein
Organism
nir  Candidatus Nitrosopumilus sediminis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPR_2 TPR_1 TPR_11 TPR_17 TPR_16 TPR_8 TPR_14 TPR_6 TPR_19 TPR_12 ANAPC3 TPR_9 TPR_7 NARP1 TPR_10 Fis1_TPR_C TPR_20 MIT Coatomer_E TPR_15 Thioredoxin_6 RPN7 HrpB1_HrpK SRP_TPR_like PPTA TPR_21 Sec16_C Lsm_interact
Motif
Other DBs
NCBI-ProteinID: AFS83003
UniProt: K0B9X5
Position
999155..999976
Genome map
AA seq 273 aa AA seqDB search
MGLFGSKDNIEDLMYNAMSLMEKNQPKGAISLFNKILKQESKNTSALFNKGLALNQIKKY
SDAITCFDILLEINPKDAQAWNNRGIAMAENGNIQAAAECYDKAIESDPKNASSYFNKGV
LLDKLQEHEEALESLEKAISMDPRKPNAMIYKGIILGKMKRHEEALNCFSNVCKKYPNNQ
DAFFQKGVQLAELGHHEKALDVFDEILKKFKDNVNVIYAKSRSKAALGQHPESLELLKQA
VSKNPKVIRSWAKEEPIFVKLHSNDQFRKLVKL
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgggattgttcggatctaaagataacatcgaagatttaatgtataatgcaatgtcactg
atggaaaagaaccagccaaaaggagcaatatcactttttaacaaaattctaaaacaagaa
tctaaaaacacttcagcgttatttaacaaaggtcttgcattaaatcaaataaaaaaatat
agtgacgctatcacatgttttgatattttattagaaatcaatccaaaagatgcccaagct
tggaacaatagaggcatagcaatggcagaaaacggcaacattcaggcagctgctgaatgt
tatgacaaagcaattgaatcagacccaaagaatgcatcatcttattttaacaaaggtgtt
ttacttgacaaactgcaggagcacgaggaggcattagaatcattagaaaaggcaatatca
atggatccaagaaaaccaaatgcaatgatctacaaagggatcatactaggaaaaatgaaa
agacatgaagaggcattaaattgtttttcaaatgtttgtaaaaaatacccaaacaatcag
gacgcatttttccaaaaaggcgtccagctagcagaactaggacatcatgaaaaagcatta
gatgtgtttgatgagattttaaagaaattcaaagacaatgtaaatgtcatttatgcaaaa
tcaagaagcaaggcagcacttgggcaacatcctgaatccctagaattgttaaaacaagca
gtatctaaaaaccccaaagtgattcggtcgtgggcaaaagaagaaccaatatttgttaaa
ttacattcaaatgatcaattcagaaaactagtaaagctatag

DBGET integrated database retrieval system