KEGG   Candidatus Nitrosopumilus sediminis: NSED_06015Help
Entry
NSED_06015        CDS       T02303                                 

Definition
(GenBank) hypothetical protein
Organism
nir  Candidatus Nitrosopumilus sediminis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SHOCT ATP-synt_B
Motif
Other DBs
NCBI-ProteinID: AFS83005
UniProt: K0BD93
Position
1000758..1001123
Genome map
AA seq 121 aa AA seqDB search
MATKKKTGYIERFLKKADKAIDEGIKRADEALEDAVEFGEMAASQAKKASEELTKKALKE
KEQIKLKGVKKINEGITAAKNATSKSEEDLITLEKLGKLRKAGVLTEKEFQEKKKKILSR
I
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaaaaaagaaaacaggatacattgaacgatttttaaaaaaagcagacaaagcg
attgacgaaggaatcaaaagagctgatgaagcattagaagacgcagtagaatttggtgaa
atggcagcatctcaagcaaaaaaagcaagtgaggagttaacaaaaaaagcattaaaagaa
aaagagcaaataaaattaaaaggagtaaaaaaaatcaatgaaggaattacggctgcaaaa
aatgcaacaagtaaatctgaagaagacctaataacgcttgaaaaacttggaaaactaaga
aaagcaggagttttaactgaaaaagagtttcaggaaaagaaaaagaaaatactctccagg
atttaa

DBGET integrated database retrieval system