KEGG   Candidatus Nitrosopumilus sediminis: NSED_06045Help
Entry
NSED_06045        CDS       T02303                                 

Definition
(GenBank) hypothetical protein
Organism
nir  Candidatus Nitrosopumilus sediminis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: zf-C2H2_4 zf-BED zf-C2H2 zf-C2H2_2 Actin_micro
Motif
Other DBs
NCBI-ProteinID: AFS83011
UniProt: K0BFE0
Position
complement(1003406..1003573)
Genome map
AA seq 55 aa AA seqDB search
MGLFKRKKDDENKTKCDVCGTELHDPERLKKHMKKAHGNVPAKKMDPNAGDGGTW
NT seq 168 nt NT seq  +upstreamnt  +downstreamnt
atgggcttgttcaaacgtaagaaggacgatgaaaacaaaacaaaatgtgatgtttgtgga
acagaactgcatgatcctgaacgattaaaaaaacatatgaaaaaagcacatgggaatgta
cctgctaaaaaaatggatccaaatgcaggagatggtggtacttggtaa

DBGET integrated database retrieval system