KEGG   Candidatus Nitrosopumilus sediminis: NSED_06055Help
Entry
NSED_06055        CDS       T02303                                 

Definition
(GenBank) YVTN beta-propeller repeat-containing protein
Organism
nir  Candidatus Nitrosopumilus sediminis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lactonase Cytochrom_D1 DUF4221
Motif
Other DBs
NCBI-ProteinID: AFS83013
UniProt: K0B9Y1
Position
complement(1004484..1005494)
Genome map
AA seq 336 aa AA seqDB search
MEKMTTIDKAAIFWSIGIVAIGVAFASFGLYSPVQSISNDYQDISQNSSEDVFFTLQGDN
SVGNIGGDVFEAGSKMTYVSVSKDRDLILATSSASDIVFVYDYQGNKLSEIAVGKTPKGV
KIHPTKDIAFVANENSGTISVIDLETWELTKEIPVGKIPHNIVFHPNGITAYVTIQGGDE
IAIIDVSSLTKIDSIPVGTLPHNLDIISDGKHLFVTNIGTNDVAVIDLIDNKIIKRISVS
TGHHGIDIPPFGNKIFVSGIGDDKVNVIDAASLELIKQIQVGKGPHGLRSDQNSNNLYVG
VTQTNEIVVIDITSLRIIDRLSVGETPFWLAIPENP
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaaaatgactacaattgacaaggctgcaattttctggtctataggaattgttgca
ataggagtggcatttgcatcttttggattatattccccggtacaatcaatttctaatgat
tatcaagacatctctcaaaattcttcagaagatgttttctttacacttcaaggtgataat
tctgtaggaaatattggtggtgatgtatttgaagcagggtctaagatgacatatgtttct
gtttcaaaggatagagatttgattttagccacaagcagtgcaagtgatattgtttttgta
tatgactatcaaggaaacaaattatcagaaattgcagttggaaaaacaccaaaaggtgta
aagattcatccaaccaaagacattgcttttgtagcaaatgaaaattctggtaccattagt
gttattgatcttgaaacatgggaattaaccaaagaaatacctgttggcaagatacctcac
aatattgtttttcatcctaatggaattactgcatatgttacaattcaagggggtgatgag
attgcaataattgatgtttcatccttgactaaaatagattcaattccagtgggcacattg
ccacataatctggatattatttctgatggaaaacatctgtttgtgacaaatatcggaaca
aatgatgttgcagtaattgatttgattgataataaaataatcaaaagaatttctgttagc
acgggacatcatggaatcgatattccaccttttggaaacaaaatttttgtttctggaata
ggtgatgataaggtaaatgtgattgatgctgcctctcttgaattaattaaacaaattcaa
gtaggaaaaggacctcatggattaagatctgatcagaattctaataatttgtatgttgga
gtaacacaaaccaatgaaattgtggtaattgatatcactagtctaagaattattgacaga
ttgtctgttggagaaactcccttttggttagcaattccggaaaatccttaa

DBGET integrated database retrieval system