KEGG   Candidatus Nitrosopumilus sediminis: NSED_06080Help
Entry
NSED_06080        CDS       T02303                                 

Definition
(GenBank) RNA polymerase Rbp10
  KO
K03059  DNA-directed RNA polymerase subunit P [EC:2.7.7.6]
Organism
nir  Candidatus Nitrosopumilus sediminis
Pathway
nir00230  Purine metabolism
nir00240  Pyrimidine metabolism
nir01100  Metabolic pathways
nir03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:nir00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    NSED_06080
   00240 Pyrimidine metabolism
    NSED_06080
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    NSED_06080
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:nir03021]
    NSED_06080
Enzymes [BR:nir01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     NSED_06080
Transcription machinery [BR:nir03021]
 Prokaryotic type
  Archaeal type
   RNA polymerase
    Core subunits
     NSED_06080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_RNApol_7kD
Motif
Other DBs
NCBI-ProteinID: AFS83018
UniProt: K0B9Y2
Position
complement(1008128..1008331)
Genome map
AA seq 67 aa AA seqDB search
MINMVDEELDEVEETPVETFEVNYACLRCGTTVSNTELSRLPEIKCICGFRVFTKVRPPV
VKTVKAI
NT seq 204 nt NT seq  +upstreamnt  +downstreamnt
atgataaacatggttgatgaagaattagatgaagtagaagaaactcctgttgagactttt
gaggtaaattatgcttgtttgagatgtggaactactgtctcaaacactgaattatctcga
ttacctgaaatcaaatgtatttgtggattcagagtatttactaaagtaagaccacctgta
gttaaaacagtaaaagcaatttag

DBGET integrated database retrieval system