KEGG   Candidatus Nitrosopumilus sediminis: NSED_06095Help
Entry
NSED_06095        CDS       T02303                                 

Definition
(GenBank) hypothetical protein
  KO
K01622  fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
nir  Candidatus Nitrosopumilus sediminis
Pathway
nir00010  Glycolysis / Gluconeogenesis
nir00030  Pentose phosphate pathway
nir00051  Fructose and mannose metabolism
nir00680  Methane metabolism
nir01100  Metabolic pathways
nir01110  Biosynthesis of secondary metabolites
nir01120  Microbial metabolism in diverse environments
nir01130  Biosynthesis of antibiotics
nir01200  Carbon metabolism
nir01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nir00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NSED_06095
   00030 Pentose phosphate pathway
    NSED_06095
   00051 Fructose and mannose metabolism
    NSED_06095
  09102 Energy metabolism
   00680 Methane metabolism
    NSED_06095
Enzymes [BR:nir01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     NSED_06095
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     NSED_06095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_3 DUF1989
Motif
Other DBs
NCBI-ProteinID: AFS83021
UniProt: K0BFE7
Position
1010109..1011242
Genome map
AA seq 377 aa AA seqDB search
MKITVSVIKADVGGVGGHTKPSDGLIEAIRNTVKNSADLLIDYYIGYCGDDTHIVMTHTH
GVDNQQIHKLAWDAFMAGTQVAKDEGLYGAGQDLLKDSFSGNVKGMGPGVAEMEFEERPN
EAFTVFAADKTEPGAFNYPIYRMFVDALSNTGLIVNKSLAAGVTMHIMDVEKAQIAELHL
WEDKPTIEAALMYPGRYVVDSVYTKDGEPILDASTDRLHNIAGTYVGKDDPICLVRTQKN
FPATEEVGSVFNNPHYVAGNTRGSHNMPLMPVKLNSAATINFCIPIVEALVFSMHNGKLT
GPFDGFSTPDWDYIREIATKKAMAIRSQGFIHPATLVPSELEYAEGYRARMDVLETKMKP
MEGTSSGEKKENYEDPD
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattacagtttcagttatcaaagcagatgtcggcggagttggcggacatacaaaa
ccaagtgatggactaatagaagcaattagaaacaccgtcaaaaattcagcagatttactc
attgattattacataggatattgtggggatgatacccatattgtaatgacacatactcat
ggtgtagacaatcaacaaattcacaaattagcatgggatgcattcatggcaggaactcaa
gtagcaaaagatgaaggattgtatggtgcaggacaagatttgttaaaagattctttttca
ggaaatgtaaaaggaatgggaccaggagttgcagaaatggaatttgaggaaagaccaaac
gaagcattcacagtatttgcagctgacaaaacagaaccaggtgcattcaactatccaatc
tacagaatgtttgtcgatgcactaagcaacacaggtcttattgtaaacaaaagtcttgca
gcaggagtaacaatgcacatcatggatgtagagaaagcacaaattgcagaattgcattta
tgggaagacaagccaactatcgaagctgcattaatgtatccaggaagatatgtggtagat
tcagtgtatacaaaagacggagaaccaatactagatgcatcaactgacagattacataac
attgcaggaacatatgttggaaaagacgatccaatttgtctagtaagaactcaaaagaac
tttccagcaacagaagaagtaggaagtgtatttaacaatccccattatgttgcaggaaac
acaagaggtagtcacaacatgccattaatgcctgtaaaactaaattcagcagctacaatc
aacttttgtattccaattgttgaagcattagtgttcagcatgcataatggaaaacttaca
ggtccatttgatggattctcaacaccagactgggattacatcagagaaattgcaacaaag
aaagccatggcaattagaagtcaaggatttattcatccagcaacactcgttccatccgaa
ttagaatatgctgaaggatacagagcaagaatggatgttcttgaaacaaagatgaaacca
atggaaggaacatccagcggcgaaaagaaagaaaactacgaagatccagattag

DBGET integrated database retrieval system