KEGG   Candidatus Nitrosopumilus sediminis: NSED_06115Help
Entry
NSED_06115        CDS       T02303                                 

Definition
(GenBank) tRNA intron endonuclease
  KO
K01170  tRNA-intron endonuclease, archaea type [EC:4.6.1.16]
Organism
nir  Candidatus Nitrosopumilus sediminis
Brite
Enzymes [BR:nir01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.16  tRNA-intron lyase
     NSED_06115
Transfer RNA biogenesis [BR:nir03016]
 Prokaryotic Type
  tRNA spricing factors
   tRNA splicing endonucleases
    NSED_06115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_int_endo tRNA_int_endo_N Ribosomal_L22e
Motif
Other DBs
NCBI-ProteinID: AFS83025
UniProt: K0BDA6
Position
1014341..1014877
Genome map
AA seq 178 aa AA seqDB search
MKSELIENRIIVWDIEDSKELFSQGYYGKPIGIPKPKIEEIDAPLILDLIEGLYLLENKK
ITITKSKQKISVEQLIEICKKEVHEFDKKYLVYKNFRDKGYIINPGIKFGCDFAVYEKGP
GIDHAPFLVQVYTRSEPIKSTGIVLAGRLASSVKKQFILAIPKDKDKVDFLALDWWKA
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgaagagtgagttaattgaaaacaggataatagtatgggatattgaagattcaaaagaa
cttttcagccaaggatattatggaaaaccaataggaataccaaaaccaaaaattgaagaa
atagacgctccattaattttggatctcattgaaggattatatcttttagaaaataaaaaa
atcacaattacaaaatcaaaacaaaaaatttcagtagagcaattaattgaaatttgtaaa
aaagaagttcatgaatttgacaaaaaatatctagtatacaaaaatttcagagataaagga
tacatcattaatcccggaatcaaattcggatgtgactttgcagtatatgagaaaggtccc
ggaattgatcacgcaccatttttggttcaagtttatacaagaagtgaaccaataaaatca
acaggaattgttttagcaggaagacttgcatcatcagtcaagaaacaattcattttggca
attccaaaagataaagataaagtagatttcttggctttggattggtggaaagcctag

DBGET integrated database retrieval system