KEGG   Candidatus Nitrosopumilus sediminis: NSED_06145Help
Entry
NSED_06145        CDS       T02303                                 

Definition
(GenBank) hypothetical protein
Organism
nir  Candidatus Nitrosopumilus sediminis
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AFS83031
UniProt: K0BFF7
Position
complement(1018865..1019488)
Genome map
AA seq 207 aa AA seqDB search
MNKFIVIPVILGIVAVILISSMSINKTPDTTSIYESGFTYYDIEKIQDTLAEKNIVVSAP
TPITDHTISQYCAYFENGLPMTVEYCTTTAVLDSEETTLGNINIGGSIQSPVMAVANLET
KTLESNQDDVVAIFETMIETLVCDCWEDEESKDYESISAWILAAQKFYSDSNGRNIKSKI
DNLSNSEIFLEITSKENSVLQTLIILK
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgaataaattcattgtgattcctgtcattcttgggattgtagcagttattttgatatcc
tctatgtcgataaataaaactcctgacactacatcaatttatgaatctggttttacctat
tatgacattgaaaaaattcaagacactctagctgaaaaaaatattgtggtgtctgcacct
actccgatcactgatcatacaatcagtcaatactgtgcatattttgaaaatggtctgcct
atgactgtggaatattgtaccacaaccgctgtattggattctgaagaaactacgctagga
aatatcaacattggaggcagtattcaatctcctgttatggcagtagctaatcttgaaact
aaaactttggaatctaaccaagacgatgttgttgcaatatttgagaccatgattgaaact
cttgtttgcgactgctgggaggatgaggaatccaaagattatgaatcaatttctgcctgg
attttggctgctcagaaattctatagtgattctaatggccggaatattaaatcaaaaatt
gataatttgagcaattctgaaatctttttagaaatcacgtctaaagaaaattcggtctta
cagacattaattattctaaagtag

DBGET integrated database retrieval system