KEGG   Candidatus Nitrosopumilus sediminis: NSED_06150Help
Entry
NSED_06150        CDS       T02303                                 

Definition
(GenBank) hypothetical protein
  KO
K09005  uncharacterized protein
Organism
nir  Candidatus Nitrosopumilus sediminis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF192
Motif
Other DBs
NCBI-ProteinID: AFS83032
UniProt: K0BD84
Position
complement(1019529..1020020)
Genome map
AA seq 163 aa AA seqDB search
MTTRAQALIPITIAAVIIGVIGMLTLPSDSKLESVEFPRGAILVDDIALEVQIADSEPRR
VRGLMFQEQLPFDQGMIFVFDEPGLYSLWMLNMQFSLDMIWFDADGNVVHIEKDVPPCKT
VVEITGCQSVVPDNEATYVLEVTSGFVEQNNITEDSKLTIISI
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgactactcgtgctcaagcattaattcctattacaatagctgccgtaatcattggggtt
attggaatgcttacgcttccaagtgacagtaaattagaatctgttgaatttcctagaggt
gctatcttagtagacgacatagcacttgaagtacaaatcgcagattctgaaccacgacgt
gttagaggattgatgtttcaagagcaattgccttttgatcagggaatgatctttgtattt
gatgaacctggattgtattctttatggatgctaaacatgcaattctctttagatatgatt
tggtttgatgctgatggaaatgttgtacatattgaaaaagatgttcctccatgtaaaact
gtagtagaaattactggttgtcaaagtgttgtacctgataacgaagcaacgtatgttctt
gaagtcacatctggctttgttgaacaaaataacattactgaagattccaaattgacaatt
atatccatttga

DBGET integrated database retrieval system