KEGG   Candidatus Nitrosopumilus sediminis: NSED_06165Help
Entry
NSED_06165        CDS       T02303                                 

Definition
(GenBank) ATPase
  KO
K06865  ATPase
Organism
nir  Candidatus Nitrosopumilus sediminis
Brite
KEGG Orthology (KO) [BR:nir00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    NSED_06165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T2SSE KH_1 KH_2 KH_5 PIN_4 AAA_16 AAA_14 AAA_22 AAA_28 AAA_18 PIN IstB_IS21 AAA_25 ArgK ABC_tran NB-ARC AAA_30 Viral_helicase1 AAA_29 Zeta_toxin NTPase_1 KTI12 AAA_33 CbiA NACHT
Motif
Other DBs
NCBI-ProteinID: AFS83035
UniProt: K0BDB6
Position
complement(1020994..1022814)
Genome map
AA seq 606 aa AA seqDB search
MTKIVSDTSVIINGQLTAQIESGSIRNSDIIIPQAVFDELQSQASKNKEQGFIGLERIQK
LKSLSGSHGLNVVVSGSHPSSDDIKLASSGRIDALIVDMAKQNNAILYTSDNVQHLVARA
EGVETVFLKSEIKNESLEFLKFFDSETMSIHLKENQCPLAKKGKPGEFVLTKLSDEILSK
DYLEMISSQILDVVNVYDSSTLEISKNGASVVQHGDYRIAITYPPFSESFEITIVHPIVK
LSLDDYTISEKLMERFSDSAEGIVISGAPGSGKSTLASGLANFYHKKGKIVKTFESPRDL
QVDPGVTQYSKLDGSFDNSADILLLVRPDYTIFDEVRRREDFGTFADLRLTGVGMVGVVH
ANSPLDAIQRFIGKIELGIIPNVLDTVVFVKDGGIQKVYDLELKVKVPTGMTESDLARPV
IEIRNFEDNVLEHEIYTFGEENVIVPVGKKADKVGIEKLAEDKIKETFKRYDPRAEVEIL
SDNRVKVMVDEQYIPSIIGRGGSNINEIEKLLRVHIDVVQKTSDDISLTTNDLPFSFSES
KTALLLTVNRDFSSMHADIYANEKFIASVRIGKKGQIKIPKRSDVARTLMDFSRSQSDIK
IFLKDF
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
ttgacaaaaattgtttctgatactagtgtaataattaatggtcagcttactgctcaaatt
gaatctggcagtattagaaattctgatatcattattccacaagctgtttttgatgaactt
caatctcaagcatcaaagaacaaagaacaaggattcattgggctggaaagaattcaaaaa
ctcaaatccttatctgggagtcatgggttaaatgttgttgttagtggttctcacccttct
tctgatgatatcaaacttgccagcagtggcaggatagatgctctaattgtcgacatggca
aagcaaaataatgctatattgtacacttctgataatgtacagcatttggttgcgcgtgct
gaaggcgtcgaaacagtatttttaaaatctgaaataaaaaatgaatctttggaatttcta
aaattttttgattctgaaactatgagcatacatcttaaagaaaatcagtgtcctttggca
aaaaaaggcaagcctggggaatttgtgctgacaaaactaagtgatgagattctttcaaag
gattatttggaaatgatctcatcacaaattttagatgtagtaaatgtgtatgattctagc
accttggagatatccaaaaatggtgcttctgtagttcaacatggcgattatagaatagct
attacatatcctcctttttcagaatcttttgagattacaatagtgcatcctattgtgaag
ttatcccttgatgattacacaatttctgaaaaattaatggagcgtttttctgacagtgcg
gaaggcattgtgatttcaggagctcctgggtctggaaaaagcactcttgcctctggtctt
gcaaatttctatcataaaaaaggaaagattgtaaaaacattcgagtctccacgtgattta
caagttgatcctggagttacccaatacagtaaacttgatggaagttttgacaattctgca
gatattttattacttgtaagaccagattatacaatttttgatgaagtaagaagacgcgaa
gattttggaacttttgctgacttgagattaactggggttggtatggtgggagtcgttcat
gcaaattccccattggatgcaattcaacgttttattgggaaaattgagcttggaataatt
ccaaatgttttggatactgtagtttttgtaaaagatggtggaattcaaaaagtgtatgat
ttggaattaaaagttaaagtcccaactggtatgactgaatccgatttggctcgacctgta
attgaaattagaaattttgaagataatgttttggaacatgaaatttacacatttggtgaa
gaaaatgtcatcgttcctgtaggaaaaaaggcagataaagttggaattgaaaaactagct
gaagacaaaattaaagaaacattcaagcgttatgaccctcgcgctgaagttgaaatttta
tctgacaatagagtcaaagtcatggtcgatgaacaatacattccatctattattggcaga
ggtggctcaaacattaatgaaatcgaaaaattactccgtgtacatattgacgttgttcaa
aaaacatctgatgatatctcactgaccactaatgatttaccatttagtttttcagaatca
aaaactgcattactgctaactgtaaatagagattttagctcaatgcatgctgacatctat
gcaaatgagaaatttattgcatctgttagaattggtaaaaaaggacaaataaaaattcca
aagcgttctgatgttgcaagaaccttgatggatttttctaggtcccaaagtgatatcaaa
atcttccttaaagatttttaa

DBGET integrated database retrieval system