KEGG   Candidatus Nitrosopumilus sediminis: NSED_06210Help
Entry
NSED_06210        CDS       T02303                                 

Definition
(GenBank) hypothetical protein
Organism
nir  Candidatus Nitrosopumilus sediminis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cauli_DNA-bind
Motif
Other DBs
NCBI-ProteinID: AFS83044
UniProt: K0BC44
Position
1029583..1029870
Genome map
AA seq 95 aa AA seqDB search
MEESDEIQKLIDEISFRKSNSKNYEKMKAIEISKELRDIMKFEQESNKKIEEFGKTHENQ
ELVEYAKIISRNTTAREIAELQETYLKKIDEEFLK
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atggaagaatcagatgagattcaaaaattaattgacgagataagttttagaaaatcaaat
tccaaaaattatgaaaaaatgaaagcgatagaaatcagtaaagagttaagggacattatg
aaatttgagcaagaatcaaacaaaaaaatcgaagagtttggaaaaactcatgaaaatcaa
gaactggtagaatatgcaaaaataatttctagaaatacaacagcaagagaaattgcagaa
ttacaggaaacatatttgaaaaaaattgatgaagaatttttaaaatga

DBGET integrated database retrieval system