KEGG   Candidatus Nitrosopumilus sediminis: NSED_06240Help
Entry
NSED_06240        CDS       T02303                                 

Definition
(GenBank) outer membrane autotransporter
Organism
nir  Candidatus Nitrosopumilus sediminis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fil_haemagg
Motif
Other DBs
NCBI-ProteinID: AFS83050
UniProt: K0BDD0
Position
complement(1034546..1035304)
Genome map
AA seq 252 aa AA seqDB search
MTNTKQILILPVLVALVSVLAFTGQDASALVSTVDDKISCNAPAIGGAWNSVTSTCVVGT
LVIGPTDKLIIGSDTTFSIGSVTSSGVIVNRGTIHIASGGVITTSGEFTNNGVIDSTKGT
ITNSGPFKNIGELTSSGTITNGPTGVIKNEGYLTSTGVITTSGAIKVGVDGVLISSGTFT
NSLNLVNSGTIMTSGTFTNSGPVMNFDTILNDGLFSNSNTITNWGNILNLCSGSITNSGT
IAIHKVIELCIA
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatacaaagcaaattctaatacttcctgtattagttgcattagtttctgtttta
gcctttactggtcaagacgcatcggcattagtttctaccgtcgatgataaaatatcttgt
aatgctccagctataggtggagcatggaactctgttacttcaacatgtgtagttggaact
cttgtaattggcccaactgataaactaattatcggttcagataccacttttagcattggt
agcgtcactagtagtggtgttatagtaaaccgtggaacaatccacattgcaagtggtggt
gtaattacaacatctggtgaatttaccaataatggtgttattgatagcactaaaggtaca
ataacaaatagcggtcctttcaagaacattggtgaactaacatcctctggaacaattact
aacggcccaacaggtgttataaaaaatgaaggttacttgacaagcactggtgtaattaca
acatctggagctatcaaagtaggtgtagatggcgtactaattagtagcggtacatttacc
aactctttgaacttagtcaacagcggcaccatcatgacatcaggcacattcaccaacagt
ggtccagttatgaattttgatacaattctaaatgacggattgttttctaatagtaacaca
atcactaactggggaaacatactcaacttgtgtagtggttcaattacaaattcaggaaca
atagctatccacaaagtaatagaactctgtatagcttaa

DBGET integrated database retrieval system