KEGG   Candidatus Nitrosopumilus sediminis: NSED_06255Help
Entry
NSED_06255        CDS       T02303                                 

Definition
(GenBank) isopropylmalate/isohomocitrate dehydrogenase
  KO
K00052  3-isopropylmalate dehydrogenase [EC:1.1.1.85]
Organism
nir  Candidatus Nitrosopumilus sediminis
Pathway
nir00290  Valine, leucine and isoleucine biosynthesis
nir00660  C5-Branched dibasic acid metabolism
nir01100  Metabolic pathways
nir01110  Biosynthesis of secondary metabolites
nir01210  2-Oxocarboxylic acid metabolism
nir01230  Biosynthesis of amino acids
Module
nir_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:nir00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    NSED_06255
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    NSED_06255
Enzymes [BR:nir01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.85  3-isopropylmalate dehydrogenase
     NSED_06255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh PdxA SeqA_N
Motif
Other DBs
NCBI-ProteinID: AFS83053
UniProt: K0BA05
Position
complement(1036248..1037261)
Genome map
AA seq 337 aa AA seqDB search
MYKISLITGDGIGPELSESVVSVLNTIHDNLDLKFDITTLSAGDKALSETGKALPDETVA
AIKQSDACMKAPVGESAADVIVVLRRMLDLYANIRPAKSYPHMPALRDDIDMVIVRENTE
DLYTGKEFSLGDSSVALRIISEAASKRIARYAFETAKQRDSMRKVTCVHKSNVMRVTDGM
FAKACTDVSKDYPDIAFEEMYVDACAMNLIRQPEQFDVVVTTNLFGDILSDESSQVVGGL
GMAPAANIGDNFALFEPVHGAAFDIAGQNIANPSSFLLSIKMMLDWLGNKHNDSKCIEVG
EKLESVIFDLVKSGVKTKDIGGTSSTTEFTKQITDNL
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaaatttcattgattactggtgatgggataggtcctgaattatctgaatctgta
gtttctgttttgaataccattcatgataatctcgatttgaaatttgatattacaacatta
tctgcaggggacaaggccttatctgaaactggaaaagcacttccagatgaaacagttgct
gctataaaacaatcagatgcttgtatgaaggcccctgttggtgaaagtgcagctgatgta
attgttgttttaaggaggatgcttgatctttatgccaatattcgacctgcaaagtcatat
ccacacatgcctgcattacgtgatgatattgatatggtcatagttcgagagaatactgag
gatctttacactggcaaagaatttagcttaggtgattcttctgtagctctaagaataatt
tctgaagctgcttctaagagaatagcaagatatgcttttgaaactgccaaacaacgtgac
tctatgagaaaagtcacatgtgttcacaaatcaaacgtgatgcgagttacagatggtatg
tttgcaaaagcttgcactgatgtttctaaagattatcctgatattgcatttgaggagatg
tatgttgatgcatgtgccatgaatttgattcgacaaccagagcagtttgatgttgttgta
actactaacttgtttggtgatattttatctgatgaatcttcacaagtagtaggtggattg
gggatggctccagctgctaacattggagataattttgcattgtttgaacccgttcatggt
gctgcttttgatattgcaggacaaaacattgcaaatccttcatcctttttgttatcaatt
aagatgatgcttgactggttgggaaacaaacacaatgattccaaatgtattgaagttgga
gaaaaactggaatctgtcatatttgatctagtaaaatctggtgtgaaaacaaaagacatt
ggcggaactagtagtactacagaatttactaaacagattacagataatctgtaa

DBGET integrated database retrieval system