KEGG   Candidatus Nitrosopumilus sediminis: NSED_06260Help
Entry
NSED_06260        CDS       T02303                                 

Definition
(GenBank) isopropylmalate/citramalate/homocitrate synthase
  KO
K01649  2-isopropylmalate synthase [EC:2.3.3.13]
Organism
nir  Candidatus Nitrosopumilus sediminis
Pathway
nir00290  Valine, leucine and isoleucine biosynthesis
nir00620  Pyruvate metabolism
nir01100  Metabolic pathways
nir01110  Biosynthesis of secondary metabolites
nir01210  2-Oxocarboxylic acid metabolism
nir01230  Biosynthesis of amino acids
Module
nir_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:nir00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NSED_06260
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    NSED_06260
Enzymes [BR:nir01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.13  2-isopropylmalate synthase
     NSED_06260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like LeuA_dimer DUF4147
Motif
Other DBs
NCBI-ProteinID: AFS83054
UniProt: K0BC52
Position
complement(1037294..1038808)
Genome map
AA seq 504 aa AA seqDB search
MKIRIFDTTLRDGEQTIGVSLSPDQKLSIAKKLDELGVDAIEAGFPVISEGELKAVKMIT
SEGLSCEIAGLTRTIKKDIDAAVDAGLNYIHTFIATSDIHLEHKLKMTRDQALEKAIEAV
EYGKSRGLQVEFSAEDASRTDREFLKKVFGEVAKAGADRVNIPDTVGYSTPEYMAKITKD
TVEATKLPVSVHCHNDFGLAVANSLAGIHAGAACAHVTINGIGERAGNASLEELSMALKC
LPYDQKYETNIKSELIYDASRFISKTVGIIVQPNKAIVGANAFGHESGIHTHGVLSNPLT
YEPISPELVGRKRWLQVGKHAGVHGMNAMLSEYGVKPTEEQSQQILDKVKVLGDQGKQIT
DVELLSIASDVLGEKDLKKIVQLTGFSVSTGIGTMPYAFVKLNIDGQDHVGTDYGVGPVD
AALNAIQKITGKLSEIRIKDYGLASISGGSSALCEVTVKVEDALGNKVSAKSVGEDIVTT
SVKAVIDAINHIMLKKLLHEKQVR
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattagaatatttgatacaacattaagagatggggaacaaacaattggtgtttct
ttatctccagatcaaaaattatccattgccaaaaaactcgatgaacttggtgttgatgca
attgaagctggttttccagtaatctctgaaggtgagttaaaagcagtaaaaatgattact
agtgaaggattgtcatgtgaaattgcaggattaacaagaactattaaaaaagacattgat
gctgcagttgacgctggattaaactacatccacacattcattgcaacttctgatattcat
ttagaacataaactcaaaatgactcgagatcaagctcttgagaaagcaattgaagcagta
gagtatggaaaatctcgtggattgcaagttgaattttcagctgaagatgcttctagaact
gatagagaatttttaaaaaaagtatttggcgaggttgcaaaagccggagcagaccgtgta
aacattcctgatactgtggggtactctactcctgaatacatggcaaaaatcactaaagat
acagtagaagctacaaaacttccagtaagtgttcattgtcataatgattttggattggca
gttgcaaattctttggcaggaattcatgcaggagctgcatgtgcacatgttacaataaat
ggaattggtgaacgagctggtaatgcttcattagaagaactttctatggcattgaagtgt
ttaccatatgatcaaaaatatgagacgaacatcaaatctgaattaatttacgatgcctca
agatttatctctaaaactgtgggtattattgttcagcctaacaaggccatagttggagca
aacgcatttggccatgaatcaggaattcatacacatggtgtattgagtaatccgctaaca
tacgagccgattagcccggaattagtaggacgaaaaagatggcttcaagttggaaaacat
gcaggggttcatggtatgaatgcaatgctttctgaatatggagtaaaacctactgaagaa
caatcccagcaaatcttagacaaagtcaaagtgttaggtgaccaaggaaaacagatcact
gatgtggagttgctctctattgcaagtgacgtcttgggagaaaaagacctcaaaaaaatt
gttcaactaactggattctcagtatccactggaattggaactatgccttatgcatttgta
aaactaaacattgatggtcaggaccatgtcggaactgattatggggtaggacctgtggat
gcagcactaaatgcaattcaaaaaattactggaaagctttctgaaatcagaattaaggat
tatggattagcatcaatttctggcggttctagtgcattatgtgaggttacagtaaaggtt
gaagatgcattaggaaacaaagtctctgcaaaatctgttggtgaagacattgtaactaca
tcagttaaagcagtaattgatgccattaatcatatcatgctcaaaaaattgttacatgaa
aaacaggtacgataa

DBGET integrated database retrieval system