KEGG   Candidatus Nitrosopumilus sediminis: NSED_06270Help
Entry
NSED_06270        CDS       T02303                                 

Definition
(GenBank) acetolactate synthase large subunit, biosynthetic type
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
nir  Candidatus Nitrosopumilus sediminis
Pathway
nir00290  Valine, leucine and isoleucine biosynthesis
nir00650  Butanoate metabolism
nir00660  C5-Branched dibasic acid metabolism
nir00770  Pantothenate and CoA biosynthesis
nir01100  Metabolic pathways
nir01110  Biosynthesis of secondary metabolites
nir01130  Biosynthesis of antibiotics
nir01210  2-Oxocarboxylic acid metabolism
nir01230  Biosynthesis of amino acids
Module
nir_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
nir_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:nir00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    NSED_06270
   00660 C5-Branched dibasic acid metabolism
    NSED_06270
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    NSED_06270
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    NSED_06270
Enzymes [BR:nir01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     NSED_06270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M TPP_enzyme_M_2
Motif
Other DBs
NCBI-ProteinID: AFS83056
UniProt: K0BFH7
Position
complement(1039297..1041009)
Genome map
AA seq 570 aa AA seqDB search
MEADLMNKMESMTGAKALMVAMEKEGVKQVFGLPGGANLPMYDEFARCNIRHILTRHEQS
AAHMADGFGRVSRKPGVCFATSGPGATNILTGIATAQADSAPMIAVTGQVPVGMIGKDAF
QESDIIGMANPVVKYAFQPRTAGEIPEVVKKGFFIAESGRPGPVLIDIPKDVQTNEEPMN
FPDEFKIQGYHPWADPDIANVEKAIDMLLHAEKPIILAGGGTIISSAFAELQAIAETLML
PVVTTFKGKGAFPENHPLSLGPIGMHGHAEANKMMSEADCVLAIGTRFSDRSVGTFEAFE
KRLKIIHMDVDPAEIGKNQTAQIAVIGDVRVNLRVMVKLLLQRAVKKSEETPWIKHVKET
KAYWKENLKLHPGEMGAAKILRKLRELLPKESVVTTEVGQHQMWASLFYDVIQPGTFFSS
TGLGTMGWGFPAAIGAKVARPDVPVVDIAGDGSFAMTENSLATAVLEDIPVIVFLLNNST
LGMVAQWQRTFYDRRMIGVDQQSCPDYVKLAESYGAQGIRAQSMDELDKAIKTALSSDVA
TVIDIPIDPEEDVLPFVAPGTSLEEMILPS
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atggaagctgatttgatgaataaaatggaaagtatgacaggtgcaaaagccttgatggtg
gctatggaaaaagaaggcgtcaaacaagtatttggcttgcctggaggtgcaaatcttccg
atgtatgatgaatttgctcgttgtaatattagacacatcttaacaagacatgaacagtcc
gcagcccacatggctgatggatttggcagagttagtagaaagccaggtgtgtgttttgca
acatctggtcctggtgctaccaatattttaactggaattgcaactgcacaagctgattct
gctccgatgattgcagtaactggacaagtacctgttggaatgataggcaaagatgctttt
caagaaagtgatattattggaatggcaaaccctgttgtaaaatatgcttttcaaccaaga
actgctggtgaaattccagaagttgtaaaaaaaggattcttcattgctgaatcagggaga
cctggacctgtgttaattgacatcccaaaagacgtacaaacaaatgaagagccaatgaat
tttccagacgaatttaaaattcaaggatatcatccttgggcagatcctgatattgccaat
gttgagaaagcaattgatatgctacttcatgcagaaaaaccaatcatattagctggtggt
ggaactataatatcatctgcatttgctgaattgcaagctattgctgaaactcttatgctt
cctgttgtaactactttcaaaggaaaaggtgcatttcctgaaaatcaccctttgtcctta
gggccaattggaatgcatggacatgcagaggcaaacaaaatgatgtccgaagctgattgt
gtattggcaattggtactagattttctgacaggtctgttggtacgtttgaggcatttgaa
aagagattaaaaattatccatatggatgttgatcctgcagagattggtaagaaccaaact
gcacaaattgctgtaattggagatgtacgtgtaaatcttagagtaatggtaaaattgctt
ttacagcgagctgtcaaaaaatctgaagagactccttggattaaacatgtcaaagagacc
aaagcttactggaaagaaaacttgaaacttcatccaggcgaaatgggtgctgctaaaatt
ttacgtaaactccgtgaattgttaccaaaagaatctgttgtgactacagaagtaggccaa
catcaaatgtgggcctcattattttatgatgtaattcaacctggaactttctttagctcc
actggacttggtacaatgggatggggatttcctgcagcaattggtgccaaagttgcaaga
cctgatgtgcctgtagttgacattgcaggtgatggaagctttgctatgactgaaaattca
cttgcaactgcagtgttggaagatattcctgtaatcgtatttctcttaaacaattctaca
ttgggaatggtagctcaatggcagagaactttctatgatagaagaatgataggtgtggac
caacaaagctgtcctgattatgttaaattagcagagtcttatggtgctcaaggaatcaga
gctcaatcaatggatgaacttgacaaggcaattaaaactgcattaagcagcgatgttgca
acagtaattgatattccaattgatcctgaagaagatgtattgccatttgtagctcctgga
acttcgcttgaagaaatgatcttgccctcttag

DBGET integrated database retrieval system