KEGG   Candidatus Nitrosopumilus sediminis: NSED_06290Help
Entry
NSED_06290        CDS       T02303                                 

Definition
(GenBank) vacuolar H+transporting two-sector ATPase F subunit
  KO
K02122  V/A-type H+/Na+-transporting ATPase subunit F
Organism
nir  Candidatus Nitrosopumilus sediminis
Pathway
nir00190  Oxidative phosphorylation
nir01100  Metabolic pathways
Module
nir_M00159  V/A-type ATPase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nir00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    NSED_06290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_F MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: AFS83060
UniProt: K0BDE0
Position
complement(1043680..1044078)
Genome map
AA seq 132 aa AA seqDB search
MSISAINSLVFQTKSTFPDLLSPKRVKLERTKFSTVKIFTVGSKSFVTSFQLAGIPGKIS
ENPQKALEEIKTLTDDSDVGLVLVSDDITESINDELTALRAEKSTLVFALPATGSEKTEV
DYRVMLKKILGV
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaatttctgccataaattcactggtttttcaaactaaatcaacctttcctgatcta
ttatcgccaaaaagggttaaattagaacggacaaaattctcaactgtgaaaatctttact
gtcggaagcaaatcttttgtaactagcttccaattagctggaattccaggtaaaatttct
gaaaatcctcaaaaagcattagaggaaattaaaacattaactgatgattctgacgttggt
cttgttttagtaagtgatgatattacagaatctattaacgatgaattaactgcacttcga
gctgaaaaatcaactttggtgtttgcattacctgcaactggaagtgaaaaaactgaagtt
gattacagagtgatgctaaagaagatacttggcgtataa

DBGET integrated database retrieval system