KEGG   Candidatus Nitrosopumilus sediminis: NSED_06295Help
Entry
NSED_06295        CDS       T02303                                 

Definition
(GenBank) hypothetical protein
Organism
nir  Candidatus Nitrosopumilus sediminis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Herpes_U55
Motif
Other DBs
NCBI-ProteinID: AFS83061
UniProt: K0BFI2
Position
1044062..1044361
Genome map
AA seq 99 aa AA seqDB search
MAEIDTQKDVYLFLHGRMDLKEKATNALTAKGFAADKIIMALPTKVGEVGDYMAMLWMPP
NPDHIKIQQITKVEEVKPEGMIGLWKGASKEDIDSIPLE
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaattgacactcagaaagacgtctatttgttcctgcatggaagaatggatctt
aaagaaaaagcaacaaatgcattgactgcaaaaggatttgcagcagataaaatcatcatg
gccttgccaactaaagttggagaggtaggagattacatggcaatgttatggatgcctcca
aatccagatcatatcaagattcaacaaatcaccaaagttgaagaagtaaaaccggaagga
atgataggtctgtggaaaggagcttcaaaagaagacatagactctattccattagagtag

DBGET integrated database retrieval system