KEGG   Candidatus Nitrosopumilus sediminis: NSED_06305Help
Entry
NSED_06305        CDS       T02303                                 

Definition
(GenBank) hypothetical protein
Organism
nir  Candidatus Nitrosopumilus sediminis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SWIM
Motif
Other DBs
NCBI-ProteinID: AFS83063
UniProt: K0BA13
Position
complement(1044663..1044965)
Genome map
AA seq 100 aa AA seqDB search
MNKDLDRIQSIVSEKRVKLHVFKPTQRKIWTVVGKGQEHWIDPDSNYCSCPGFYFGKLIG
KTICYHLESAHLARHQNQVEEIVFSDDEFSDFLSGLIDDL
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaagatctggaccgaatccaatctattgtttctgaaaaacgtgtaaagttgcat
gttttcaagcccacacaaagaaagatttggactgttgttggaaaaggccaagaacattgg
attgatcctgattctaattactgctcttgtcctggattttactttggaaaactaattgga
aaaactatttgctatcatttggagtctgctcatcttgctagacaccaaaaccaagtggaa
gagattgttttttctgatgatgaattttctgattttctttcaggtctaattgatgatctg
taa

DBGET integrated database retrieval system