KEGG   Candidatus Nitrosopumilus sediminis: NSED_06315Help
Entry
NSED_06315        CDS       T02303                                 

Definition
(GenBank) hypothetical protein
Organism
nir  Candidatus Nitrosopumilus sediminis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Zn-ribbon_8 DUF2513 HypA HxlR Elf1
Motif
Other DBs
NCBI-ProteinID: AFS83065
UniProt: K0BDE4
Position
complement(1045750..1046202)
Genome map
AA seq 150 aa AA seqDB search
MAKKFSDDELDEVLSKIEKFDADGIRFIHLKNSVKKNFVKIKIAEFKLKDILVFLDENGL
VQRIPFDDKPGFHDLTLYRISEKGRDLIAKFTREPNDDWNKNSYLSNVSCQNCGNSYEMR
VAYSETVKTWAKSQRCPNCAFKGMFVTKFI
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaaaattctctgatgatgaacttgatgaagttctaagtaaaattgagaaattt
gatgctgatggaattagatttattcatttaaaaaatagtgtaaagaagaattttgtaaaa
ataaagattgcagaatttaagcttaaagatattttggtctttcttgatgaaaatggactc
gtccaaagaattccgtttgatgataaacctggttttcatgatttgactctttaccgcatt
tctgagaaaggaagagatttgattgctaaatttactcgtgaaccaaatgatgattggaac
aagaacagctatctatcaaatgtctcatgtcaaaattgtggtaactcttatgaaatgcgt
gttgcatattctgaaactgtcaaaacatgggcaaaatcacaaagatgtcctaactgtgct
ttcaaaggaatgtttgttactaaatttatctga

DBGET integrated database retrieval system