KEGG   Candidatus Nitrosopumilus sediminis: NSED_06370Help
Entry
NSED_06370        CDS       T02303                                 

Definition
(GenBank) pyridoxamine 5'-phosphate oxidase family protein
  KO
K07006  uncharacterized protein
Organism
nir  Candidatus Nitrosopumilus sediminis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Putative_PNPOx Pyridox_ox_2 DUF2255 TFIIE_alpha F420H2_quin_red Pyrid_ox_like TbpB_B_D
Motif
Other DBs
NCBI-ProteinID: AFS83074
UniProt: K0BC71
Position
1056894..1057262
Genome map
AA seq 122 aa AA seqDB search
MINLDEIKSEKYISLETYRKNNQPVRTPVWFVVKDDLIYVVTRSKTGKVKRLKNNLQVKF
ALCTIKGKVTGEWISGTATILNEEETKKAVKRRDKKYGFMAKISKFLSKSKGGFFAFTIK
AD
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgataaatttagacgaaattaaatccgaaaaatatatctcgcttgaaacttatcgaaaa
aataatcaaccagttagaacaccagtatggtttgtagtcaaagatgatttgatttatgtc
gtcacacgcagtaaaacaggcaaggtaaaacgtctaaaaaacaatttacaagtaaaattt
gcattgtgtacaattaaaggtaaagttacaggagaatggatttcaggaactgccacaatt
ctaaatgaagaagagactaaaaaagcagtaaagagaagggataaaaaatatgggtttatg
gcaaaaatttcaaaattcctgagtaaaagcaagggaggattttttgcatttacaattaag
gcagattaa

DBGET integrated database retrieval system