KEGG   Candidatus Nitrosopumilus sediminis: NSED_06375Help
Entry
NSED_06375        CDS       T02303                                 

Definition
(GenBank) phosphoesterase DHHA1
  KO
K07463  archaea-specific RecJ-like exonuclease
Organism
nir  Candidatus Nitrosopumilus sediminis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHHA1 DHH Utp14
Motif
Other DBs
NCBI-ProteinID: AFS83075
UniProt: K0BDF3
Position
complement(1057321..1058463)
Genome map
AA seq 380 aa AA seqDB search
MAVSKTKKSTTTVKKKATKKVAKKVAKKTAAKKPVKKTVAKKVTKKSASKKTTKPQRTKV
ICISHKEDCDGISSAAIIRQAFGGDAILVDYPGQMEALNQVVLDEKLKSLFICDLGLSKK
TQDEFIDILTTLRKNKVSVTYIDHHDIDPDVVKALKKIKVKVIHDINECTAVLAYTAFKS
KLNDHASFVAACAAITDYMETRPIGAKLLQIYDRQFALISATVLTYNIVGHQKEPDYLLY
LVEELAESKFPHAIPNTFEFAQIQVEKLSQMIAKVKQGMKTMKNLGYMEILDAGASGAVN
FVMGLSGKDVGVAYKERVDHGIYAVSVRGSKDCKVHLGKIVNTLATSLGGSGGGHDKACG
AVIPKPKIKKFITELNKQIK
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
ttggcagtatctaaaactaaaaaatctaccaccactgttaagaaaaaagcaactaaaaaa
gtagcaaaaaaagttgccaaaaaaacagcagcaaaaaaacctgttaagaaaactgttgca
aaaaaagtaacaaagaaatctgcatctaaaaaaactacaaaaccacaaagaactaaagtg
atttgtatttctcacaaagaagattgtgatggtattagttctgctgcaattatcagacag
gcatttggcggtgatgcaatactggttgactatcctggacaaatggaagcactaaatcaa
gtggttttagatgaaaaattaaagtcattatttatttgtgatttgggtcttagtaaaaaa
acccaggatgaatttattgatattttaacaactctgagaaaaaacaaagtctcagtaact
tacattgatcatcatgatatagaccctgatgttgtaaaggcattaaaaaaaataaaagta
aaggtgattcatgacatcaatgaatgtactgctgttttagcttacactgcattcaaatca
aaattaaatgatcatgcatcatttgttgcagcatgtgctgcaattactgactacatggaa
actagaccaataggtgcaaaattactgcaaatctatgaccgacaatttgcattgattagt
gcgactgttcttacttacaatattgtggggcatcaaaaagaacctgattatctattgtac
cttgttgaggagttggctgaatccaagttccctcatgcaatacctaacacttttgaattt
gctcaaattcaagttgagaaactatctcagatgattgccaaagtaaaacaaggaatgaaa
actatgaaaaatcttggttatatggaaattttagatgctggtgctagtggtgctgtgaat
tttgtaatgggattgtctggaaaggacgtcggcgttgcatacaaagaaagagttgatcat
ggaatctatgctgtatctgttcgtggctctaaagattgcaaagtccatcttgggaaaatt
gtcaacaccttggctactagtcttggcggttctggtggaggtcatgacaaggcatgtggt
gccgtaattcctaaacccaaaataaaaaaattcattacggaattaaataagcaaatcaaa
taa

DBGET integrated database retrieval system