KEGG   Candidatus Nitrosopumilus sediminis: NSED_06420Help
Entry
NSED_06420        CDS       T02303                                 

Definition
(GenBank) pyridoxamine 5'-phosphate oxidase-like FMN-binding protein
  KO
K07005  uncharacterized protein
Organism
nir  Candidatus Nitrosopumilus sediminis
Brite
KEGG Orthology (KO) [BR:nir00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    NSED_06420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridox_ox_2 Putative_PNPOx Pyrid_ox_like
Motif
Other DBs
NCBI-ProteinID: AFS83084
UniProt: K0BC79
Position
complement(1068652..1069362)
Genome map
AA seq 236 aa AA seqDB search
MMFFKLSCILGILILWIYNIISLNYFMQLTGILQIKSYEKVKEFLNDEHVGRIASIDVNG
FPQIIPMNFVFLNDAVYMHSHVKGEKLDNISRNNKVGFEADRELEFLPSYFEDPHNASLA
DTLYISIVIKGVASFVSDREEKTLALNGLMEKYQPEGKYDPISSDMRVLDAVSVIKVAPQ
TLHGKYKIGQHMSPDDRMNLAQKILKRNSPSALETLKIMGFEVTDTGLKMIDEPVW
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgatgttttttaaattatcttgtattttaggaattttaatactctggatttataatatt
atttcattaaattactttatgcagttaactggaattctccaaattaaatcatatgaaaag
gtaaaagaatttttgaatgatgagcatgtaggacgtattgctagcatcgatgtgaatggc
tttcctcaaataatccctatgaactttgtatttcttaatgatgcagtttacatgcattct
catgtaaaaggtgagaaattagataatatttctagaaataacaaagtgggattcgaagct
gacagagagctagaatttttgccctcatattttgaagatccacacaatgcatctttggca
gatacattatacatcagcattgtaatcaaaggagtggcttcttttgtatctgacagggaa
gagaaaacgcttgcactaaacggattaatggaaaaatatcaacctgaagggaagtatgat
ccaattagttctgatatgagggttttagatgctgttagtgtgattaaagttgctcctcaa
acacttcatggaaaatacaaaattggtcaacacatgagtccagatgataggatgaatctt
gcccaaaaaattctaaagagaaattcaccatctgctcttgaaacattgaaaattatggga
tttgaggtaactgatacgggtttgaaaatgattgatgaacctgtatggtga

DBGET integrated database retrieval system