KEGG   Candidatus Nitrosopumilus sediminis: NSED_06425Help
Entry
NSED_06425        CDS       T02303                                 

Definition
(GenBank) hypothetical protein
Organism
nir  Candidatus Nitrosopumilus sediminis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_pol_Rpc34 tRNA_synt_2f
Motif
Other DBs
NCBI-ProteinID: AFS83085
UniProt: K0BDG0
Position
1069794..1070207
Genome map
AA seq 137 aa AA seqDB search
MSEIDEEREEATKITLDLLEEWGSDSKFIWFRELHRITDIDKGLLRNILNDLKKSKEIKE
MHGTNNRIFFCLRKYYIKCRDVEFRFKGKQIMLRDGSKTKIIQGSTNATERTRKRLEKQK
NKRRAKSFTKKKRPHKS
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaatagatgaagagcgagaagaagccaccaagataacactagatcttttagaa
gaatggggttctgattcaaaattcatctggtttagagaactacacagaattactgatatc
gacaagggattattgcgaaatatactcaatgacttgaaaaaatcaaaagagatcaaagag
atgcatggaacaaacaatagaatatttttttgtctaagaaaatattatatcaaatgtaga
gatgttgaatttcgattcaagggcaaacaaataatgttaagagatggaagtaagacaaaa
attattcaaggttcaacaaatgcaacagagaggactaggaaaagattagaaaaacagaaa
aacaaacgcagggcaaaatcatttactaaaaagaaaaggcctcataaatcataa

DBGET integrated database retrieval system