KEGG   Candidatus Nitrosopumilus sediminis: NSED_06430Help
Entry
NSED_06430        CDS       T02303                                 

Definition
(GenBank) hypothetical protein
Organism
nir  Candidatus Nitrosopumilus sediminis
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AFS83086
UniProt: K0BFK2
Position
complement(1070202..1070432)
Genome map
AA seq 76 aa AA seqDB search
MDDDLPESVKKCLDILEENVEILANLEYDLDDEKNDELTPDMELHDLFDMTEDVAESARI
KRAESNFTRRQAEDSL
NT seq 231 nt NT seq  +upstreamnt  +downstreamnt
atggatgatgaccttccagaatcagtaaaaaaatgtcttgatattttagaagagaatgtg
gaaattttggcaaatcttgaatatgatctagatgatgaaaaaaatgatgaattgacccct
gatatggaattacacgacttgtttgatatgactgaagatgttgcagaatctgcaaggata
aaacgtgcagaatccaattttacgcgacgtcaagctgaagactctttatga

DBGET integrated database retrieval system