KEGG   Candidatus Nitrosopumilus sediminis: NSED_06545Help
Entry
NSED_06545        CDS       T02303                                 

Definition
(GenBank) hypothetical protein
Organism
nir  Candidatus Nitrosopumilus sediminis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OpcA
Motif
Other DBs
NCBI-ProteinID: AFS83109
UniProt: K0BCA4
Position
1096810..1096941
Genome map
AA seq 43 aa AA seqDB search
MKARFNGKCVECGDVIKTGKEILKNSKDQWVHKACCDLEEELP
NT seq 132 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccagatttaatggaaaatgtgtagagtgtggagatgtcattaaaacaggaaaa
gaaattctaaaaaactctaaggaccaatgggttcacaaagcatgttgtgatctagaggaa
gaactgccataa

DBGET integrated database retrieval system