KEGG   Candidatus Nitrosopumilus sediminis: NSED_06550Help
Entry
NSED_06550        CDS       T02303                                 

Definition
(GenBank) hypothetical protein
Organism
nir  Candidatus Nitrosopumilus sediminis
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AFS83110
UniProt: K0BDI4
Position
1096997..1097428
Genome map
AA seq 143 aa AA seqDB search
MNEMNVKPNLLLIASIMTVFGVLVIPADISAEVNQVTVTPINEKVSLEKTITTMNVPLDN
KLPWGTVRGGASDVAERYPIIIQFYKGGDPVHFAQVDAKGDGSYEYKFRVRNLDSNTGEF
VNVFEGDYTVKIYKVIPNTNDLT
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgaaatgaatgttaagccaaatctgttgttaattgcatcaattatgacagtattt
ggagtattggtaattccagcagacatttctgcggaggttaatcaagtcacagtaactcca
ataaatgaaaaagtaagtttggaaaaaacaataactacaatgaatgttcctttagacaat
aaacttccatggggaactgttagaggaggagcatcagacgttgctgagagatatccaatc
atcattcaattttacaaaggaggggatccagttcactttgcacaagtagatgcgaaaggc
gacggatcttatgaatacaaattcagagttagaaatctagattcaaacacgggcgaattt
gtaaatgtgtttgaaggggattatactgtaaaaatatacaaagtcattccaaatactaat
gatttaacataa

DBGET integrated database retrieval system