KEGG   Candidatus Nitrosopumilus sediminis: NSED_06560Help
Entry
NSED_06560        CDS       T02303                                 

Definition
(GenBank) zinc finger UBP-type protein
Organism
nir  Candidatus Nitrosopumilus sediminis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: zf-UBP Prok-RING_2
Motif
Other DBs
NCBI-ProteinID: AFS83112
UniProt: K0BDF7
Position
1098063..1098317
Genome map
AA seq 84 aa AA seqDB search
MAKECEHFLQEKNVSQNRKSCEECEKEHLPVVALRMCLTCGHVGCCDSSIGKHATKHFEE
TGHPVMQAVPENIWKWCYIHKEYY
NT seq 255 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagaatgcgagcattttcttcaagaaaaaaatgtatctcaaaatagaaaaagt
tgtgaagaatgtgaaaaagagcacctcccagttgttgcacttagaatgtgtctaacatgc
ggacatgtaggttgttgcgattcatctattggaaaacatgcaacaaaacactttgaagaa
acaggacatccagtaatgcaagcagttccagaaaatatttggaagtggtgttatattcac
aaagaatattactga

DBGET integrated database retrieval system