KEGG   Candidatus Nitrosopumilus sediminis: NSED_06570Help
Entry
NSED_06570        CDS       T02303                                 

Definition
(GenBank) transcription factor TFIIB cyclin-related protein
  KO
K03124  transcription initiation factor TFIIB
Organism
nir  Candidatus Nitrosopumilus sediminis
Pathway
nir03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:nir00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    NSED_06570
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:nir03021]
    NSED_06570
Transcription machinery [BR:nir03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIB
     NSED_06570
 Prokaryotic type
  Archaeal type
    TFB
     NSED_06570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TFIIB TF_Zn_Ribbon Sigma70_r4 RB_B Ribosomal_L11 Sigma70_r4_2 zinc_ribbon_2 HTH_AsnC-type Cyclin_N DZR HTH_23 HypA A2L_zn_ribbon
Motif
Other DBs
NCBI-ProteinID: AFS83114
UniProt: K0BCB0
Position
complement(1098944..1099891)
Genome map
AA seq 315 aa AA seqDB search
MVLHLVLEIINADSTCGRCGKNSMLTDNVTGERFCGKCGYVITETLQDSGPEWRSFSKEG
GADPTRTGAPTSLAMHDRGLATIISPMNKDSSGKPLTSTMKSTIERLRTWDSRSKVNASS
DKNLRQALSELSTLKDKLSLSDAVIEKASYIYRKALEKGLVKGRSISALIAASLYAACRD
TETPRTLKDVSDAGNIKKKDISRCYRILHQELELKMPVVDPVQCVARIASSIGITEKTKR
YAVKVLKDAQAHEESAGKDPMGLAAAALYLSCVKNGEDKTQRDIAEAANVTEVTIRNRYK
GLRLDQNMDMLGGKS
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggtattacacttggttttagaaattattaatgctgattcgacatgcggtcgttgcgga
aaaaattccatgctgactgataatgtcactggtgaaagattctgtggtaaatgcggttat
gtgatcactgagactctacaagactccggccctgaatggagatcattttcaaaagaaggt
ggtgcagatccaacaagaactggagctcccacatcgcttgcaatgcatgacagaggactt
gcaacaattatcagtcctatgaataaggactcttctggaaaacctctgacctctaccatg
aaaagtacaattgaaagattgagaacttgggatagtagaagtaaagtaaatgcttcttca
gataaaaatctcagacaagcactaagtgaattatctacattaaaagacaaactttcatta
tctgatgcagttattgaaaaagcatcatacatttacagaaaagccttagaaaaaggtctt
gtaaaaggtcgttctatatctgcattaattgcagcttctctttatgctgcatgtagagac
actgaaacccctagaactctaaaagatgtttcagatgcaggtaatattaagaaaaaagac
atttcaagatgttatagaattttacatcaggaattagaactaaaaatgcctgttgtggat
cctgttcaatgtgttgcaagaattgcaagctctattggaattactgaaaaaacaaaacgt
tatgcagttaaagtactcaaagatgcacaagcacatgaagagtctgcaggaaaagatcct
atgggattagctgctgcggcattatacctttcttgtgtcaaaaacggtgaagataaaact
caacgtgatattgcagaggccgcaaatgttactgaagtaacaattagaaatagatacaaa
ggcttgagattagatcaaaatatggatatgctgggaggaaaatcataa

DBGET integrated database retrieval system