KEGG   Candidatus Nitrosopumilus sediminis: NSED_06630Help
Entry
NSED_06630        CDS       T02303                                 

Definition
(GenBank) UspA domain-containing protein
Organism
nir  Candidatus Nitrosopumilus sediminis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Usp Glyco_hydro_36N
Motif
Other DBs
NCBI-ProteinID: AFS83124
UniProt: K0BCC1
Position
complement(1109355..1109786)
Genome map
AA seq 143 aa AA seqDB search
MVFKNILVPYDGTNFSNRAFRKALDIAKKDGSKITVFTVIEGEYSAIRGFSKVNPQTIKK
QQSAAKKFIYKLEQTAKSLNVPISVKIKQGTSIVKEIINLANLKKSDLIVMGSHGRTGLN
KLILGSVTYGVAQQAKCSVMVVK
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggttttcaaaaatattctagtgccatatgatggtacaaatttttccaatagagcattt
agaaaagcattagatattgcaaaaaaagacggttctaaaattactgtatttacagtcata
gaaggagagtattctgcaataaggggattttctaaagttaaccctcaaacaataaaaaaa
caacaaagtgcggctaaaaaatttatttacaaacttgagcaaactgcaaaaagtctcaac
gttccaatatctgtgaaaatcaaacaagggacatctattgttaaagagataatcaatctc
gcaaatttaaaaaagtcagatctcatagtaatggggtctcatggcagaacaggtttgaat
aaattaattctgggtagtgttacatatggtgttgcgcaacaagcaaaatgttcggtaatg
gtggtaaaataa

DBGET integrated database retrieval system