KEGG   Candidatus Nitrosopumilus sediminis: NSED_06645Help
Entry
NSED_06645        CDS       T02303                                 

Definition
(GenBank) hypothetical protein
Organism
nir  Candidatus Nitrosopumilus sediminis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: zf-HIT DUF1258 PolC_DP2
Motif
Other DBs
NCBI-ProteinID: AFS83127
UniProt: K0BDH2
Position
1112767..1112949
Genome map
AA seq 60 aa AA seqDB search
MRVDSCRKCGMELTIKQECSICNEPIKFSCKECYFEPEEQIHSLCKLVDMNHKPLISETA
NT seq 183 nt NT seq  +upstreamnt  +downstreamnt
atgagagttgatagttgtagaaaatgtggaatggaactaacaatcaaacaagaatgttca
atttgtaatgaaccaatcaagttcagttgcaaagaatgctattttgaaccagaagagcaa
attcattcattatgcaaattagtagatatgaatcataaaccattaatttcagaaacagca
taa

DBGET integrated database retrieval system