KEGG   Candidatus Nitrosopumilus sediminis: NSED_06650Help
Entry
NSED_06650        CDS       T02303                                 

Definition
(GenBank) hypothetical protein
Organism
nir  Candidatus Nitrosopumilus sediminis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hemerythrin DUF1786
Motif
Other DBs
NCBI-ProteinID: AFS83128
UniProt: K0BA62
Position
complement(1113274..1113819)
Genome map
AA seq 181 aa AA seqDB search
MSATNQLRADHDQVKRLEKIVFKCSEELKKGADIPFSDLSKIMIVISEFIDTIHHSREEN
SYFPCVSDHGSLKDEIHRFLVEHEFGRNVARLISRHLKLWKEGSDEREPVSRYLNAYGVF
LKDHLHKENKFFDTAEANVLTKEEEANMYEEYKSVFAIVKKVEDMIKEIDYLESRPWNLS
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcaactaaccaactacgtgcagatcatgatcaagtgaaacgtcttgaaaaaata
gtcttcaaatgctctgaggaattaaaaaaaggtgcagatattcccttttcagatttatca
aaaattatgattgtaatttctgagtttattgatactattcatcattctagagaagaaaat
tcctatttcccatgcgtgtcagatcatggttctctaaaagatgagattcaccgatttcta
gttgaacatgaattcggaagaaatgttgcacgtctaatatcacgtcatcttaaattgtgg
aaagaaggatctgatgaaagggaacctgtttcaagatatcttaatgcatacggtgtattt
ctaaaagatcatttgcacaaagaaaacaaattttttgatactgctgaagctaatgtcttg
acaaaggaagaagaggctaacatgtacgaggaatacaaatcagtgtttgcaatagtaaaa
aaagtagaagacatgattaaagaaattgactatttagaatctagaccttggaatttgtca
aagtag

DBGET integrated database retrieval system