KEGG   Candidatus Nitrosopumilus sediminis: NSED_06660Help
Entry
NSED_06660        CDS       T02303                                 

Definition
(GenBank) sensor protein
Organism
nir  Candidatus Nitrosopumilus sediminis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dCache_1 HAMP Guanylate_cyc IFT57 DUF485 DUF2015
Motif
Other DBs
NCBI-ProteinID: AFS83130
UniProt: K0BDJ8
Position
complement(1114152..1115822)
Genome map
AA seq 556 aa AA seqDB search
MLAISIASIAVTTGLAYNFTDTIIKNNIKESLKDESETRGNTISSIIESRINKLQSFSQN
QAIKNAFNVLIPGIDDVSFHNILEEQLPLIQTEFYSFQLNEFEAGLRDLQIINMRGKPIF
SLNEKIDPITYIKGNFKVSKPTVEFVQDVDKTRLIKISLPIFSENGNQQGVLIASMGSGV
FDNVLLNRFGLHDTGEVYLVNQNRMMISESIFLENTPFNQKVDTFAVSECFDNGKNVEAE
VYPDYRNVDIFGYSYCAKDLGFVLLTEVDESAILKPITELQNMIILVGISLIVIASVVTF
ILSRRISQPILKLRDAAQQLSSGNFDVRTNIQTNDEIEQLSTSFDDMAKTIQETISAIGK
RENIIKQQGNILSRFFEEKHDSYVCLIDLVGSLKITKSLTIEQKQQYGKIFSDAVIPIIK
KYKGIPIKIVDDAILFYFPLTEDEDVLTNMLKCCLELSKMDKEINAKTKSENLPGISYRI
SSAFGLVHEAKTSDSSLDDIFGEPVNIAFKINQYALPNTIVIDNSVYERAKKLDFKFTKL
DQSLIRDLEYSIFIVT
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgcttgcaatcagtatagcatcaatagctgtaaccactgggcttgcgtataatttcaca
gacactataattaaaaacaacatcaaagaatccctaaaagatgaatctgaaacaaggggt
aatacaatttcttcaataattgaatcaagaattaacaaacttcagagtttttctcagaat
caggcaatcaaaaatgcatttaatgtattaatccctggaattgatgatgtatcatttcat
aatattttagaagaacaactaccactaattcaaaccgaattttattcatttcaactaaat
gaatttgaagctggattacgagatcttcaaattattaacatgcgaggaaaacctatcttc
tcattaaatgaaaaaattgatccaataacatacatcaaaggtaatttcaaagtcagcaag
cctactgtggaatttgtacaggatgtagacaaaactagattgataaaaatatcattgccg
atattctctgaaaatggtaatcagcagggtgtattgattgcatcaatgggaagtggggtc
tttgataatgtgttgcttaatagatttgggttacatgatactggtgaagtttatctagta
aaccaaaacagaatgatgatttcagaatctatctttttagaaaatacgccatttaatcaa
aaagtagacacatttgcagtctcagaatgttttgataatggtaaaaatgttgaagcagaa
gtttatcctgattaccgaaatgtagacatctttggatattcttattgtgctaaagacttg
ggatttgttttattgactgaggttgatgaatctgctattctcaaacctataacagaatta
caaaatatgataattctagttggaatcagtcttattgtcattgcaagtgttgttactttt
attctctcaagaagaatatctcaaccaattctcaaactacgtgatgctgcacaacaattg
tcttcaggcaattttgatgtacgaacaaacattcaaacaaatgatgagattgaacagcta
tcaacatcatttgacgatatggcaaaaaccattcaagaaacaatttcagctataggtaaa
cgagaaaatattatcaaacaacaaggcaatattttatccagattttttgaagaaaaacac
gatagctatgtatgtcttatagacttggtaggttctcttaagataacaaaatcattgact
atagaacaaaaacaacaatacggtaaaattttctctgatgctgttattcctattataaaa
aaatacaaaggaatcccaatcaaaatagtggatgatgcaattcttttctatttccccttg
actgaagatgaggatgttttgacaaatatgctcaaatgttgtcttgaattatcaaaaatg
gataaggagatcaatgctaaaacaaagtctgaaaatcttcctggaatttcatatagaatc
agttctgcatttggactggtccatgaagcaaaaacatctgattcctcattggatgatatt
tttggagaacctgtcaacatcgcctttaagattaatcaatatgcattacccaatacgatc
gtaatagataattcagtatatgagagagccaagaaactagatttcaagtttacaaaactg
gatcaaagtctcatcagggatttggaatattctatttttattgtcacttag

DBGET integrated database retrieval system