KEGG   Candidatus Nitrosopumilus sediminis: NSED_06695Help
Entry
NSED_06695        CDS       T02303                                 

Definition
(GenBank) hypothetical protein
Organism
nir  Candidatus Nitrosopumilus sediminis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CsgA Erf4 Muted
Motif
Other DBs
NCBI-ProteinID: AFS83137
UniProt: K0BDI1
Position
complement(1122936..1123340)
Genome map
AA seq 134 aa AA seqDB search
MSFIADGVAIALKGIGIALFLFVIFLIIVAVVNWYVSSQEMLHRNAEVVAENIPVIVENV
IKSCSAVDNALSSLNETLAENLQNEIARNLAKKLLDQERLSECEWQEFVSHLNEWEKRRL
NVYDLACDISSCVK
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgagtttcattgctgatggagtagccattgcactaaaaggaattggcatagcgctattc
ctctttgtgatatttttaataattgtcgcagtggtaaattggtatgtttctagccaagaa
atgctacatagaaatgcagaagtggttgcagaaaacatacctgtaatcgtggaaaatgtg
attaaatcatgttcagctgttgataatgcattgagttcattaaatgaaacattagcagaa
aatctacaaaatgagattgcaaggaatttggctaaaaaattacttgatcaagaaagatta
tccgaatgtgaatggcaggaatttgtaagtcatttgaatgaatgggaaaaaagaagatta
aacgtatatgatcttgcatgtgatatttctagttgtgtaaaataa

DBGET integrated database retrieval system