KEGG   Candidatus Nitrosopumilus sediminis: NSED_06715Help
Entry
NSED_06715        CDS       T02303                                 

Definition
(GenBank) hypothetical protein
Organism
nir  Candidatus Nitrosopumilus sediminis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2513
Motif
Other DBs
NCBI-ProteinID: AFS83141
UniProt: K0BFP1
Position
1126132..1126494
Genome map
AA seq 120 aa AA seqDB search
MGNDPILRKDIIFCLVEYGQKSVPELTKIFVKDNRFKNRKSETIRGAISVLQERNLVENS
CDVDATQGNQEKKFNLTNLGFEWFLQKFKIDSKIFWRKLLDVGLISNDYHYTTKKKVKIQ
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
ttgggcaatgatccaatattacgaaaagatataattttttgtctagtggaatatggacaa
aaatcagttccagaattgaccaaaatatttgtcaaagataatagattcaagaatagaaaa
agtgaaacaattcgaggagcaatttcagttttacaagaaagaaatttggtagaaaattca
tgtgatgtagatgcaactcaagggaatcaagaaaaaaaattcaacctaactaatcttggt
tttgaatggtttttacaaaaatttaaaatagattccaaaatattttggagaaaattgtta
gatgtagggttgatttcaaatgattatcattacaccacaaagaaaaaggtaaaaattcaa
taa

DBGET integrated database retrieval system