KEGG   Nitratiruptor sp. SB155-2: NIS_0395Help
Entry
NIS_0395          CDS       T00565                                 

Gene name
ndk
Definition
(GenBank) nucleoside-diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
nis  Nitratiruptor sp. SB155-2
Pathway
nis00230  Purine metabolism
nis00240  Pyrimidine metabolism
nis01100  Metabolic pathways
nis01110  Biosynthesis of secondary metabolites
nis01130  Biosynthesis of antibiotics
Module
nis_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
nis_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
nis_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:nis00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    NIS_0395 (ndk)
   00240 Pyrimidine metabolism
    NIS_0395 (ndk)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nis04131]
    NIS_0395 (ndk)
Enzymes [BR:nis01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     NIS_0395 (ndk)
Membrane trafficking [BR:nis04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    NIS_0395 (ndk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: BAF69509
UniProt: A6Q200
Position
385755..386168
Genome map
AA seq 137 aa AA seqDB search
MERTLSIIKPDAVAKNVIGKIIDRFETNGLRIAAMKKIQLSKNDAAKFYEVHKERPFFND
LVDYMTSGPVVVMVLEGENAVAKNRELMGATDPKEAKPGTIRADFAESIEANAVHGSDSL
ENAQKEIAFFFAQREIL
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atggaaagaacactctcaattatcaagccagatgccgtagcgaaaaatgtaatcggtaaa
attatcgatcgatttgaaacaaatggtctcagaattgctgctatgaaaaagattcagctt
tcaaaaaatgatgcagcaaaattttatgaagttcacaaagaaagacctttctttaacgat
cttgtagattacatgacaagtggtcctgtagtcgttatggtattggaaggggagaatgcc
gttgcaaaaaatagagaattgatgggtgcaactgatcctaaagaagcgaaacctgggaca
atacgagcagattttgctgaaagtatcgaagcaaatgcggtacatgggagtgacagtttg
gaaaatgcacaaaaagagatagctttcttttttgcacaaagggaaattctttaa

DBGET integrated database retrieval system