KEGG   Nitratiruptor sp. SB155-2: NIS_0547Help
Entry
NIS_0547          CDS       T00565                                 

Definition
(GenBank) cytochrome c peroxidase
  KO
K00428  cytochrome c peroxidase [EC:1.11.1.5]
Organism
nis  Nitratiruptor sp. SB155-2
Brite
Enzymes [BR:nis01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     NIS_0547
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CCP_MauG Cytochrom_C
Motif
Other DBs
NCBI-ProteinID: BAF69661
UniProt: A6Q2F2
Position
complement(542926..544053)
Genome map
AA seq 375 aa AA seqDB search
MKKIFILIVLPFLIITTPYILGKVNTYVTLHTPVQQISPQQLRQLAISAGFRSNPKNFDE
LLKLLDTPSNRLTKEKILLGKMLFFDPSLSKDRTISCASCHDLDRGGDDDRPTAIGYKNR
KNPHHLNSPTVLNAALQKFQFWDGRAKSVEEQAKGPLQAPFEMAMTPKEVVERVRQNPSY
RKMFQEVFGDDTITFDQITKAIGAYERTLLTRGRFDDFLDGNLSALTPKEQKGLKLFINI
GCKACHMGRSVGGQIIQKFPVIEYHSPIYPVFGFYDNKYYFKELRFDTNISYDPYPFPDI
GHYYGKNSARYFKVPILRNITKTAPYFHNGTVKNLKEAIRIMGKYQRGLELNKEQIDSIE
AFLHTLEGNIIDYGI
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatatttattcttattgttttgccatttcttatcattactactccctatatt
ttaggaaaagttaacacctatgttacacttcatacacccgtacagcaaatatctcctcaa
cagcttcggcaattggcaatttctgctggatttcgatccaatccaaaaaattttgatgag
cttttaaaacttctcgatacaccatccaatagacttacgaaagaaaaaattcttcttggg
aagatgctctttttcgatccaagtctctccaaagatcgaactatcagctgtgcaagttgt
catgatcttgacagaggcggagatgatgacaggccaacggcaatcggttacaaaaaccga
aaaaatcctcatcatcttaactccccaaccgttctcaatgccgcccttcaaaagtttcaa
ttttgggatggaagagcaaaaagtgtagaagagcaggcaaaaggtcctttgcaagcaccg
tttgaaatggcaatgacgccaaaagaggtggtggaacgggtacgacaaaatccatcttac
cgcaagatgtttcaagaggtttttggcgatgacaccattacatttgatcaaattacaaaa
gcgataggagcgtatgaacgaacgcttcttacacgagggcggtttgatgattttcttgat
ggcaatttaagtgcattgactccaaaagagcaaaaaggattaaaactttttatcaatatc
ggctgtaaggcctgccatatgggacgcagcgttggcggacagataatacaaaaatttcca
gttatcgaatatcatagccctatctatccggtttttgggttttatgacaataaatattat
ttcaaagagttgcgttttgatacaaatatctcgtacgatccctacccgtttccagatatt
ggtcattactacggaaaaaacagtgccagatattttaaagtaccaatcttgcgcaatatc
accaaaacagccccctattttcacaacggcaccgtcaaaaacctcaaagaggctattcgg
ataatgggaaaataccaaagaggattggaattaaacaaagaacaaattgatagtattgag
gcatttttgcatacccttgaaggaaatataatcgattatggtatttaa

DBGET integrated database retrieval system