KEGG   Nitratiruptor sp. SB155-2: NIS_0932Help
Entry
NIS_0932          CDS       T00565                                 

Definition
(GenBank) pyruvate/2-oxoglutarate dehydrogenase complex, E2 component, dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nis  Nitratiruptor sp. SB155-2
Pathway
nis00010  Glycolysis / Gluconeogenesis
nis00020  Citrate cycle (TCA cycle)
nis00620  Pyruvate metabolism
nis01100  Metabolic pathways
nis01110  Biosynthesis of secondary metabolites
nis01120  Microbial metabolism in diverse environments
nis01130  Biosynthesis of antibiotics
nis01200  Carbon metabolism
Module
nis_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nis00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIS_0932
   00020 Citrate cycle (TCA cycle)
    NIS_0932
   00620 Pyruvate metabolism
    NIS_0932
Enzymes [BR:nis01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     NIS_0932
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding QRPTase_N PTS_EIIA_1 PYNP_C ATP-synt_ab_Xtn Peptidase_M23 RnfC_N
Motif
Other DBs
NCBI-ProteinID: BAF70043
UniProt: A6Q3I4
Position
complement(945308..946534)
Genome map
AA seq 408 aa AA seqDB search
MDYKIVMPVLSDTMDKGKLIKWHVKEGDVVHKGDVIAEVESDKAIMEVQTFKDGVVKKLL
VKEGDEVPVKEPIAILDTEVKEPVTKTQASEQKEQPKEKTVVQKEESKPQTPQKSEVPPV
LQELMPTSTSPSVEGYASPAAKKAAAKANIDIESLQKEGILPKPAHLKDINEELLKRYFT
PKALHLLQEYQIDAKKFSMDHKINEKEVQDFILKNNIPKPVPLSSNQKAVKQNVEGSTKK
PTYLIMETFDIKPYEDVKLTSVFIKTIADVMQRHPLTRAVLDGERYLVYPTSNISVAVAK
GNDLFMVVCKNAEQKSLEEIDEWVRGLKKRNYSAEELSGSTFGISNLGMFGIDRFSAMIN
KKDSGIAAFGALNNGKIKVTFTFDHRVLNGVDAAKFVSDLKNSFKGNG
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggattataaaattgttatgccggtcctgtcggatacgatggataaaggaaagttgatc
aaatggcatgtaaaagagggagacgttgtccataaaggggatgtgattgcggaagtggag
agcgacaaggctataatggaggtgcaaaccttcaaggatggagtggtaaaaaaactgctt
gtcaaagagggtgacgaggttcctgtcaaagaaccaattgcgattctcgatacggaggta
aaagagcctgtcacaaaaacacaggcttccgaacaaaaagagcagccaaaagagaaaaca
gttgtgcaaaaagaggaatctaaaccacagactcctcaaaaaagcgaagttccccctgtt
cttcaagagttgatgcccacatccacatcgccttcagtggaaggctacgcttcgccagcg
gcaaaaaaagcggctgcaaaggccaacatcgatatagagtctcttcaaaaagagggtatt
ttgccaaaaccagctcaccttaaagatatcaacgaagagcttttaaaaagatactttacg
ccaaaagcgctgcatctgttgcaggagtaccaaatcgatgcaaaaaaattctcgatggat
cataaaataaacgaaaaagaggtacaggacttcatcctcaaaaacaacattccaaaacct
gttcccctctcttccaaccaaaaagctgtgaaacagaatgttgaaggctccacgaaaaaa
ccaacctatttgattatggagacctttgatattaagccatatgaggatgtaaagctcact
tccgtgtttattaaaacgatagccgatgttatgcagcggcaccctttgacaagagctgtc
ctggatggtgaacggtatctcgtctatcccacatcaaatatcagtgtagctgtggcaaaa
gggaatgatctatttatggtggtgtgcaaaaatgccgagcaaaagagtttagaagagata
gatgagtgggtccgagggcttaaaaagagaaattatagtgcagaagagctgagtggttca
acctttggaatcagtaatcttggaatgtttgggattgaccgttttagcgcgatgatcaat
aaaaaagattctggtattgctgcttttggagcactgaataatggaaaaataaaagtcacc
tttacatttgatcacagagttttaaatggagtggatgctgcaaaatttgtgagtgatcta
aaaaacagttttaaaggaaacggatga

DBGET integrated database retrieval system