KEGG   Nitratiruptor sp. SB155-2: NIS_0938Help
Entry
NIS_0938          CDS       T00565                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
nis  Nitratiruptor sp. SB155-2
Pathway
nis00010  Glycolysis / Gluconeogenesis
nis00052  Galactose metabolism
nis00500  Starch and sucrose metabolism
nis00520  Amino sugar and nucleotide sugar metabolism
nis00521  Streptomycin biosynthesis
nis01100  Metabolic pathways
nis01110  Biosynthesis of secondary metabolites
nis01120  Microbial metabolism in diverse environments
nis01130  Biosynthesis of antibiotics
nis01200  Carbon metabolism
Module
nis_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
nis_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nis00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIS_0938
   00052 Galactose metabolism
    NIS_0938
   00500 Starch and sucrose metabolism
    NIS_0938
   00520 Amino sugar and nucleotide sugar metabolism
    NIS_0938
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NIS_0938
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    NIS_0938
Enzymes [BR:nis01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     NIS_0938
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: BAF70049
UniProt: A6Q3J0
Position
complement(952263..952958)
Genome map
AA seq 231 aa AA seqDB search
MKLALDIGGTYIRWEMMNGIKGKERLDRIELQTFIEKLIKKGKITHVGIAYAGQVFNNEI
LSAPNIHAAFNPKKLGLPYILENDLKCAVLAEARYFNASFITALYSGTGLGSATIEQGDL
VRGFRNLSGEIGHIPYKKAPFRCGCGKDNCIELFASGSGLQKWANYLKIEPSLENQTLFN
LYLEALLYASSTLLTLCNPKILVLGGGVIQNNSFIIDQIKQKIDAYAPPSH
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgaaactggctcttgatatcggaggaacctatatcagatgggaaatgatgaatggcata
aaaggaaaagagcggcttgatcgaattgaattgcagacatttattgagaaattgatcaaa
aaaggtaaaatcacccatgtaggcatcgcctatgccgggcaggtttttaataatgaaata
ctctctgcacccaatatccatgccgctttcaatcctaaaaaattgggacttccctatatt
ttggaaaacgatcttaaatgtgccgttttggcggaagcacgatatttcaatgcatctttt
atcacagctttatactccggaacgggtctgggaagtgcaaccatagagcaaggagacctc
gttcgtggatttcgcaatctctcgggagaaataggacatatcccctataagaaggctcct
tttcgttgtggctgtggaaaagataactgtatagaactttttgcatcggggagtggtcta
caaaagtgggcaaattatctcaaaatagagccttctttggagaatcaaacattgttcaat
ctctatttagaagctctcttgtatgcatcttctaccttgttgaccctctgtaatccgaaa
atactagtactgggaggaggggtaatacagaataactcgtttataatcgatcaaataaag
caaaaaatcgatgcttatgctcccccttcgcattga

DBGET integrated database retrieval system