KEGG   Nitratiruptor sp. SB155-2: NIS_1490Help
Entry
NIS_1490          CDS       T00565                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nis  Nitratiruptor sp. SB155-2
Pathway
nis00010  Glycolysis / Gluconeogenesis
nis00051  Fructose and mannose metabolism
nis00562  Inositol phosphate metabolism
nis01100  Metabolic pathways
nis01110  Biosynthesis of secondary metabolites
nis01120  Microbial metabolism in diverse environments
nis01130  Biosynthesis of antibiotics
nis01200  Carbon metabolism
nis01230  Biosynthesis of amino acids
Module
nis_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
nis_M00002  Glycolysis, core module involving three-carbon compounds
nis_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:nis00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIS_1490 (tpiA)
   00051 Fructose and mannose metabolism
    NIS_1490 (tpiA)
   00562 Inositol phosphate metabolism
    NIS_1490 (tpiA)
Enzymes [BR:nis01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     NIS_1490 (tpiA)
Exosome [BR:nis04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   NIS_1490 (tpiA)
  Exosomal proteins of bladder cancer cells
   NIS_1490 (tpiA)
  Exosomal proteins of melanoma cells
   NIS_1490 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: BAF70597
UniProt: A6Q538
Position
complement(1514644..1515342)
Genome map
AA seq 232 aa AA seqDB search
MILAANFKMNHTRASTKAYIERLNAYGKQTDIDIAVFPPATALDQYETFADIGAQNAYAA
EHGSFTGEIGLQQLQEFGIETVLLGHSERRHIFYESQEMIARKFAFYKERGFTIYYCLGE
TLQTRKKGFEAIRELLQSQLEGIDTAYENFVIAYEPVWAIGTGVAAKPEEIEEVLAYLAS
LTDAPLLYGGSVKPANIKEVLSIPKCDGALIGTASWDVENFIKMIEIAKEMR
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgatacttgcagcaaacttcaagatgaatcacactagagcttcgacgaaagcgtatatc
gagaggctcaatgcatatggaaagcaaacagatatcgatatagccgtatttcctcctgca
actgctcttgatcagtatgaaacgtttgcagatattggagcgcaaaatgcatacgctgcc
gaacacggctcttttacaggcgaaatagggttgcagcaacttcaagaatttggcattgaa
accgttcttctgggacatagtgagcgaagacatatattttacgaatcacaagagatgatt
gcaagaaagtttgcattctataaggaacggggttttacgatctactactgtcttggggag
acccttcaaacgagaaaaaaaggttttgaagcaattcgagagcttttacaaagtcagctt
gaaggtatcgatacagcttatgaaaatttcgttatcgcctatgaacctgtatgggctatc
ggtacgggagttgctgcaaaaccggaagagatagaagaggttttggcttatcttgcatca
ctgacagatgctccacttctatatggtggcagtgtgaaaccggcaaatatcaaagaggta
ctttccataccaaaatgtgatggagcgcttatcggcacggcaagttgggatgtagagaat
tttataaagatgatagaaatagcaaaggagatgagataa

DBGET integrated database retrieval system