KEGG   Nitratiruptor sp. SB155-2: NIS_1630Help
Entry
NIS_1630          CDS       T00565                                 

Definition
(GenBank) Ham1 family protein
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
nis  Nitratiruptor sp. SB155-2
Pathway
nis00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:nis00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    NIS_1630
Enzymes [BR:nis01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     NIS_1630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like
Motif
Other DBs
NCBI-ProteinID: BAF70736
UniProt: A6Q5H7
Position
complement(1640136..1640723)
Genome map
AA seq 195 aa AA seqDB search
MKVILASSNKGKIKEIEQMMHMDVIPYKELLGDLEIVEDGKSFKENAIIKAKTIYDALGD
KEAVVISDDSGITVPILGDEPGIYSARYAGVGASDKENLYKLINRLKEKGIKRTPAYYTA
AIAIASKYGIDTVHGWMWGEVIDEARGKKGFGYDPMFIPKGFDKTLGELDEEIKKSISHR
AKALELAKIILKRWE
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttatattagcctcttcaaataaaggaaagatcaaagaaatagagcagatgatg
catatggatgttattccatataaagagttgctgggtgatcttgaaattgtagaagatggg
aaaagtttcaaagaaaatgccattatcaaagcgaaaacgatctatgatgctttaggcgac
aaagaggctgtggtgatctctgatgacagtgggattacggtaccaattttaggagatgag
cctggaatatattctgcaaggtatgcaggtgttggagccagcgacaaagagaatctatat
aaattgattaacaggctcaaagaaaaagggatcaaacgaacccctgcatactatacggcc
gctatcgccatcgcctccaaatatggcatagatacggttcatggatggatgtggggtgag
gtgatcgatgaagcaagaggaaaaaaagggtttggctatgatccgatgtttatcccgaaa
ggtttcgataaaacattgggggagctggatgaggagatcaaaaagagtatcagccacaga
gcgaaagctctcgaattagcgaaaattattttgaagaggtgggaatga

DBGET integrated database retrieval system