KEGG   Nitratiruptor sp. SB155-2: NIS_1666Help
Entry
NIS_1666          CDS       T00565                                 

Gene name
ispC
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
nis  Nitratiruptor sp. SB155-2
Pathway
nis00900  Terpenoid backbone biosynthesis
nis01100  Metabolic pathways
nis01110  Biosynthesis of secondary metabolites
nis01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nis00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NIS_1666 (ispC)
Enzymes [BR:nis01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     NIS_1666 (ispC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXP_reductoisom DXPR_C Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: BAF70772
UniProt: A6Q5L3
Position
complement(1678052..1679116)
Genome map
AA seq 354 aa AA seqDB search
MKIALLGSTGSIGTNTLKICKQFGIEVEVLVAGNNIEFLKKQIEIFHPRIVVTANPCKID
APVVLHGEDGILAALAMCESELVVNALVGFLGLRPTLKAIELGKRVALANKESLVVAGKF
IDTSKITPIDSEHFGLWYLLQNSFKPKRLILTASGGAFRDWKIEKIASATLQDALKHPNW
SMGTKITIDSATMVNKLFEVLEAYWLFGCDNIDGVIEPSSIVHGIVEFIDGSTTFHASIP
DMKLPIAYALGISNQPILESVDIFKIKTAFEPIDQKRYPVWQIKERLLKRPELGVVVNAA
NEAAIEQFIEGQKAFGFIAEAVLRSIEKFFDTEVQSVEAIFAIDKKVRGYVQTL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagcgcttcttggctccactggttcgatcggaacaaatacgctgaaaatttgt
aagcagtttggaatcgaagttgaggtactggtagctggaaacaacatcgagtttttgaaa
aagcagatagagattttccacccaagaattgtcgttaccgctaatccatgtaagattgat
gctcctgtcgttttgcatggtgaagatgggattttggcagcgcttgcaatgtgtgagagt
gaactggttgtcaacgctcttgtgggatttttgggacttcggcccacactcaaagctatc
gaacttggcaaacgagtggccttggccaacaaagagtcgcttgtagtggcgggaaaattt
atagatacctccaaaattacgccgatcgatagtgaacattttggactttggtaccttttg
caaaacagtttcaaaccaaaacgactcattttgacggccagtggcggggcttttcgcgac
tggaagatagaaaagattgcgagcgctacactgcaggacgccctgaaacatcccaactgg
agtatgggaacgaaaatcaccatcgacagtgcaaccatggtcaataagctttttgaagtt
ttggaagcctactggctttttggatgtgacaatattgatggagtgattgagccaagctcg
attgttcatggaattgtggaatttatagacggcagcaccacatttcatgcgagcataccc
gatatgaaacttcccattgcctatgctcttggtatcagtaatcagccaatcctggaatct
gtagatatttttaagataaagacagcctttgagccaattgaccaaaaacgttatcctgta
tggcagataaaagagcggcttctcaagcgccctgaacttggtgttgtagtcaatgcggcc
aatgaagcggcaatcgaacaatttatcgaaggtcagaaagcttttgggtttattgcagag
gctgttttgcgaagtatagagaaatttttcgatacagaagtgcagagcgtggaagctata
tttgcaatagacaaaaaggtgcgcggctatgttcaaactctttaa

DBGET integrated database retrieval system