KEGG   Nitrosomonas sp. AL212: NAL212_0028
Entry
NAL212_0028       CDS       T01443                                 
Name
(GenBank) P-type conjugative transfer protein TrbJ
  KO
K20266  type IV secretion system protein TrbJ
Organism
nit  Nitrosomonas sp. AL212
Pathway
nit02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:nit00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    NAL212_0028
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:nit02044]
    NAL212_0028
Secretion system [BR:nit02044]
 Type IV secretion system
  Trb secretion system protein
   NAL212_0028
SSDB
Motif
Pfam: Abhydrolase_11 TMEM234 T4SS
Other DBs
NCBI-ProteinID: ADZ27978
UniProt: F0TD16
Position
pNAL21201:complement(31291..32091)
AA seq 266 aa
MINSKNLAIQWIAISLSLGILSYSSINKAGGMAVIDMANVKQSTITAIEAINQTEKQIEQ
YRTQLQQYENMIRNTLAPPAYVWAKVEYTMTKLINLSNSIRYYEQQYGGLDSYMQRFRNV
EYYRSSSCFTLEEKCSDSAWKLLQDGQNTSTDSQKHANDSLLRGLSEHQNQIPLDAAHLQ
LLQQKTQSAQGQMEAFQYANQLAAYQANQLLQMRQMLIAQHNAFNTKNQAEVDQKAMQQA
AREAATKRLSPEILPAGRNWSVRDAF
NT seq 801 nt   +upstreamnt  +downstreamnt
atgataaatagtaaaaatctagctattcagtggatcgcaatatcattaagcctgggtatt
ttaagctattcctcaatcaataaagccggtggaatggctgtcatagatatggcaaatgta
aaacaatccaccattacagcgattgaagcaatcaatcaaactgaaaagcaaattgagcaa
tacagaacccagttacagcagtatgaaaacatgattcgcaatactttggcaccaccggct
tatgtatgggcgaaggtagaatacaccatgactaagctaataaatttatccaattccata
cggtattatgaacaacaatatggaggtctagacagctacatgcaacggtttcgtaatgtc
gaatattaccgtagctcatcttgtttcactttagaggaaaaatgtagcgattccgcctgg
aaactattacaggatggacaaaacacgagtacagactcacaaaaacatgctaatgattcc
cttttacgagggcttagtgagcatcaaaatcagattcctctggatgcggctcatttgcaa
cttttacagcaaaaaactcaatcagctcaagggcaaatggaagcttttcagtatgccaat
caattggccgcctatcaagcgaatcagctgttgcaaatgcgtcaaatgctgatagctcag
cacaatgctttcaatacaaaaaatcaggctgaggtagatcaaaaagccatgcaacaggcc
gcgcgtgaggcagcaaccaagcgattgagtcctgaaatattacctgctggtagaaattgg
tcggtaagagacgctttttaa

DBGET integrated database retrieval system