KEGG   Nitrosomonas sp. AL212: NAL212_0031
Entry
NAL212_0031       CDS       T01443                                 
Name
(GenBank) P-type conjugative transfer protein TrbG
  KO
K20532  type IV secretion system protein TrbG
Organism
nit  Nitrosomonas sp. AL212
Pathway
nit02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:nit00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    NAL212_0031
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:nit02044]
    NAL212_0031
Secretion system [BR:nit02044]
 Type IV secretion system
  Trb secretion system protein
   NAL212_0031
SSDB
Motif
Pfam: CagX
Other DBs
NCBI-ProteinID: ADZ27981
UniProt: F0TD19
Position
pNAL21201:complement(34034..34942)
AA seq 302 aa
MKPLLSLRKLSTLIFSLGLVAPSYAAGLSDAYFTDKNPQLTPQERAAIDLAKKWQAVNPS
GTKPVAGPDGSIRFLFGSQQPSIVCAVLQVCDIELQPGEQVNSIHLGDQARWLVEPAVTG
QGALEVQHLIIKPLDVGLETSLVVTTNRRTYHMRLRSHRRDFMPRVGFTYPEDALAKWDA
IKSRESHAMDIRRSNTIAQTGEYLGNLDFAYSVDGSAAWKPLRVYNDGHKTIIQMPSIMA
QTEAPTLLLLTKEGGLFREDETVMVNYRLQGDRYIVDAVFDKAMLIAGVGGNQSRVTITR
GN
NT seq 909 nt   +upstreamnt  +downstreamnt
atgaaaccgttactctctttaagaaagcttagcacgctgattttctctcttggactcgtt
gcaccaagctatgctgctggtttgtctgatgcgtatttcaccgataagaaccctcaactg
acaccacaggaacgtgccgctattgatctagccaagaaatggcaagcagtcaatcctagt
ggcacaaaacctgttgcaggaccggatggatcaatccgttttctgtttggttcacagcaa
cccagcatcgtctgtgcagtattgcaggtatgcgatattgaattgcagccgggagaacag
gtgaattccatccatctgggcgatcaggcgcgttggctggttgaaccggcagtgacaggg
cagggggctctagaggtacaacatttaattataaaacccttggatgtgggtctggagaca
tcgcttgttgttacgactaaccggcgcacgtatcacatgcgattgcgatcccatcggcgt
gatttcatgccgagagtgggttttacgtaccctgaggatgcgttggccaaatgggatgcg
attaaaagccgtgaaagccatgcgatggacattagaaggtcaaatacgatagcgcaaacc
ggagaatatctgggtaatctggattttgcgtattcagtagacggtagtgctgcctggaaa
cccttgcgtgtctataacgatggtcacaaaaccatcatccaaatgccatccattatggcg
cagacggaggcaccgactttactgttgttaactaaggaaggcgggctgtttagagaggat
gagacggtcatggtgaattaccgcttgcaaggtgatcgctatatcgtagatgccgtgttt
gacaaggcaatgttgattgcgggtgtaggtggcaatcaaagccgggtgacgattacgcgg
gggaattga

DBGET integrated database retrieval system