KEGG   Nitrosomonas sp. AL212: NAL212_0056
Entry
NAL212_0056       CDS       T01443                                 
Name
(GenBank) conjugative transfer signal peptidase TraF
Organism
nit  Nitrosomonas sp. AL212
SSDB
Motif
Pfam: Peptidase_S26
Other DBs
NCBI-ProteinID: ADZ28004
UniProt: F0TD42
Position
pNAL21201:58549..59088
AA seq 179 aa
MKKPIKILAVSVLAVSVSLFVLSIGFRISGIYINTTPSLPVGFYKVVDEPILSGAYVAFC
PQQDEVFDMARDRSYINQGDCPGGYGLLLKRVFALSGDTVSIDQTGIFVNGEHLPNSAQL
KTDAEGQPLPQYRLKAVLNDSEYLLLSDLNPQSFDARYFGLIARSQIQQVVRPIFTWSH
NT seq 540 nt   +upstreamnt  +downstreamnt
atgaaaaaaccaataaaaatcctggctgtttctgttctggcagtgagcgttagcctattt
gtgctaagtattggttttcgaatcagcggaatttatatcaataccacgccaagcttgccg
gtgggtttctacaaagtcgttgatgaaccgattttaagcggcgcttatgtcgctttctgt
ccgcagcaagacgaggtttttgatatggccagggatagatcctacatcaatcaaggggat
tgccctggcggttatggcttgctgctgaaacgtgtctttgcactatccggagatacggtc
tccatcgatcaaacgggcatctttgtgaatggtgaacatttacccaacagcgcccagtta
aaaaccgatgctgagggtcaaccattgccgcaataccggcttaaagctgtgctcaatgat
tccgagtacctgcttctatccgatttgaacccacaatcctttgatgcgcgctatttcgga
ttgattgcacgctcgcagattcaacaggttgtccgtccgatttttacctggagtcattaa

DBGET integrated database retrieval system