KEGG   Nitrosomonas sp. AL212: NAL212_0549Help
Entry
NAL212_0549       CDS       T01443                                 

Definition
(GenBank) ApaG domain protein
  KO
K06195  ApaG protein
Organism
nit  Nitrosomonas sp. AL212
Brite
KEGG Orthology (KO) [BR:nit00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    NAL212_0549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: ADZ25493
UniProt: F9ZDK2
Position
436549..436932
Genome map
AA seq 127 aa AA seqDB search
MIEEKKYEIEVSVRTVYLPDQSDEESERHVFAYTITIANNGTVATQLISRHWIIDNGDGT
IQEVRGLGVVGEQPLLKPGDSFEYTSGTVISTSVGSMKGSYQMAAEDGFHFDVAIPEFIL
SVPRTLH
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaagagaagaagtatgaaatcgaagtcagtgttcgtaccgtatatctgcccgat
cagtcggatgaggaatcggaacggcacgtgtttgcatataccattacgattgcaaataac
gggacagttgcgacccaactcatcagtaggcattggattatcgataacggagatggcacg
attcaggaagtgcgcggattgggcgttgtgggcgaacagccgttgctcaagccgggagat
agttttgaatataccagtgggacggtgatttctacgtcggttggatcaatgaaaggtagc
tatcagatggcagctgaagatggttttcattttgatgtggccataccggagtttatcctg
agtgttcccagaacgctgcattag

DBGET integrated database retrieval system