KEGG   Nitrosomonas sp. AL212: NAL212_0573Help
Entry
NAL212_0573       CDS       T01443                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
nit  Nitrosomonas sp. AL212
Pathway
nit00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nit01100  Metabolic pathways
nit01110  Biosynthesis of secondary metabolites
nit01130  Biosynthesis of antibiotics
nit01230  Biosynthesis of amino acids
Module
nit_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nit00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NAL212_0573
Enzymes [BR:nit01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     NAL212_0573
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ADZ25516
UniProt: F9ZDU3
Position
complement(455845..456705)
Genome map
AA seq 286 aa AA seqDB search
MSDILSKILTVKKQEIAAAKALKSYSILLQEAQSAAPPRDFVAAIQNKIAAGKSAVIAEI
KQASPSKGVLRGGSSGSAHSFAFVPAEIAQTYAQHGAACLSVLTDQKFFMGNPEYLQRAR
NACSLPVLRKDFILEEYQIAETRAMNADCILLIVSAFLLECGNPPGNLKNESLERMLKLE
QLAHSLGMAVLVEVHDAAELEMALQLSTPLIGINNRNLHTFATSLDTTLNLLHSIPPQKI
VVTESGIHTPADVARMRTHQVNTFLVGEAFMRAEDPGIELARLFFN
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatattctaagcaaaatactcactgtcaaaaaacaagaaatagcagccgccaag
gcattaaagtcttattcaatattacttcaagaagcacaatccgcagcaccaccgcgagat
tttgtcgctgccattcaaaataaaattgctgcaggaaaatcagcggtcatcgctgaaatt
aaacaggccagcccgagcaaaggtgttttacgcggcggctcctcgggaagcgcgcattcc
tttgcgtttgttcctgccgaaatagctcagacctatgctcagcatggcgcagcctgcctt
tccgtattgaccgaccagaaattttttatgggcaaccccgaatatttgcaaagagcaaga
aatgcctgttcacttcccgtgttacgtaaggatttcattctggaagagtatcagattgct
gaaacccgcgcgatgaacgcagattgcattttattgatcgtaagcgctttcttgctggaa
tgcggcaatccacccggaaatctaaaaaatgaatctctggaacgcatgttaaagcttgag
caactggctcactcgctgggaatggctgttctggtagaagtccatgatgccgctgaactg
gaaatggctttgcagttatccacaccattaatcggaatcaataatcgcaacctgcatact
tttgcaacatcactcgatacaaccttgaacttgctgcactcaattccaccgcaaaaaatt
gtcgtaaccgaaagtggaattcatacgcctgcagatgttgcgcgcatgcgtactcaccaa
gttaacacatttcttgtcggggaagctttcatgcgcgcggaagatccgggcatcgaactg
gcgcgtttgttttttaattga

DBGET integrated database retrieval system