KEGG   Nitrosomonas sp. AL212: NAL212_0979Help
Entry
NAL212_0979       CDS       T01443                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
nit  Nitrosomonas sp. AL212
Pathway
nit00260  Glycine, serine and threonine metabolism
nit00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nit01100  Metabolic pathways
nit01110  Biosynthesis of secondary metabolites
nit01130  Biosynthesis of antibiotics
nit01230  Biosynthesis of amino acids
Module
nit_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nit00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NAL212_0979
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NAL212_0979
Enzymes [BR:nit01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NAL212_0979
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth
Motif
Other DBs
NCBI-ProteinID: ADZ25899
UniProt: F9ZFZ7
Position
894800..895663
Genome map
AA seq 287 aa AA seqDB search
MSLDSIKNLLNFFSGQSDAKRTNRIAKTFAKLKQQNRKALIPFITAGDPHPKYTVPLMHQ
LVESGADIIELGVPFSDPMADGPTIQRSSERALKHHVSLDDVLRLVVEFRKINTNTPVVL
MGYANPVEALGHISFAVKARDCGVDGVLIVDYPPEESSEWVQCLEQHQIDAIFLLSPTTH
QQRIEQVAKIAKGYIYYVSLKGVTGASHLDLQDVGTKLEQLRQYISLPIGVGFGIRDGAT
ARAIAELADAVVVGSRIIEEIEKSSESDLLRNVGNQIKALRDAIDEN
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgagcctagatagtattaaaaatttactaaatttttttagcgggcaaagcgatgctaaa
agaaccaatcgtattgctaaaacatttgccaaattaaaacaacaaaatcggaaggctttg
attcctttcattacggcgggtgatccacatccaaaatatactgttccattgatgcatcaa
ttggttgagtcaggtgctgatattattgagttgggggttcctttttccgatcccatggca
gatgggcctactattcaaagatcttcagaacgagctttaaaacatcatgttagtctggat
gatgtgttgaggttggtggttgaattcagaaaaataaatacaaatacgccagttgttttg
atgggatatgcaaatcctgttgaagcactaggtcatatttcatttgctgttaaagcgaga
gactgtggggttgatggcgtgcttattgttgattatcctccggaagaatcaagtgaatgg
gtacaatgtttggagcagcatcaaattgatgcaatctttttattgtctcccacaacgcat
caacagcgcatcgagcaagtggcaaagatagcgaaaggctatatttactatgtttctcta
aaaggggttaccggtgcatcgcaccttgatctgcaggatgtcggcaccaagctggaacaa
ttgcgtcagtatatttccttgccaatcggcgttggatttggcatacgcgatggtgcgaca
gccagggcgattgcagaattggcagatgctgtggttgtaggtagcagaataattgaggaa
attgagaagtcttctgagtcagatttattaagaaatgtcgggaatcagataaaagcgcta
cgtgatgctattgatgagaattag

DBGET integrated database retrieval system