KEGG   Nitrosomonas sp. AL212: NAL212_1041Help
Entry
NAL212_1041       CDS       T01443                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
nit  Nitrosomonas sp. AL212
Pathway
nit00330  Arginine and proline metabolism
nit00332  Carbapenem biosynthesis
nit01100  Metabolic pathways
nit01130  Biosynthesis of antibiotics
nit01230  Biosynthesis of amino acids
Module
nit_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:nit00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    NAL212_1041
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    NAL212_1041
Enzymes [BR:nit01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     NAL212_1041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ADZ25958
UniProt: F9ZG56
Position
complement(956666..957775)
Genome map
AA seq 369 aa AA seqDB search
MLKQARRIVIKVGSSLVTNQGKGLDHSALAGWAAQIATLKQMNKDIVLVSSGAIAEGMQR
LNWEIRPTALYELQAAAAVGQMGLAQAYASNFSQYHLQTAQVLLTHEDLSNRKRYLNARS
TLTTLLKLNIIPIINENDTVATDEIRFGDNDTLAALVTNLIEADVLVILTDQAGLYTSDP
RRNPDAKLLNEVNAGDSALEKMAGGVGSSISRGGMQTKVIAAKRAARSGANTIVASGHEN
NVLVRLSQDEAIGTRFLARIPVLAARKQWLADYLPVRGYVTLDQGAVKALCVDRKSLLPI
GVTSVEGEFERGETVACLDKEGREIARGLINYSAVETQKILQQTSSKIEVLLGYVDEPEL
IHRNNLVLL
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgttaaagcaagcacgccgtatcgttatcaaagtaggcagcagtctggtaaccaatcag
ggtaagggactagaccattccgccttggccggctgggcagcacaaattgccacattaaaa
cagatgaataaagatatcgtgctggtttcttcaggcgcaatcgctgaaggtatgcaacga
ctcaattgggaaattcgtcctaccgcactgtacgaattacaagccgcggccgctgtaggg
caaatgggactggcgcaagcttatgcctcaaatttttcacaataccatttgcaaactgcc
caagtacttctaactcatgaagacttatccaaccggaaacgctatcttaatgcccgttcc
actctgaccaccttgttaaaactcaatatcattcccatcattaacgagaatgatacggta
gcgacggatgaaatccgttttggcgacaatgacacactggcggcactggtgaccaatctg
attgaagcggatgtactggtaatactgacggatcaggctggtttatacacaagcgacccg
cgcagaaatccggatgcaaagctactaaatgaagtcaatgcaggcgattccgcattggaa
aaaatggccggtggcgtgggtagcagtatcagccgcggcggcatgcaaaccaaagtaatc
gccgctaaacgcgctgcccgtagcggcgcgaatactatcgtagcgtccggtcacgaaaat
aacgtgctggtgcggctaagtcaggacgaggctatcggcacacgcttcctagccagaata
cctgttttggcggcacgcaagcaatggctggctgattacttgccggtgcgtggttatgtc
acattggatcagggagctgtaaaagcgctttgcgtcgatagaaaaagtctgttgcccatt
ggagtcactagcgtggagggtgaatttgagcgcggagaaacggtagcctgtctcgacaag
gaaggcagagagatagcccgcggtttgataaattacagtgcggtagaaacacagaaaatc
ctgcagcaaaccagcagtaaaatagaagtcctattgggctatgtcgatgaaccggagctc
atccatagaaataatcttgtactgctttag

DBGET integrated database retrieval system