KEGG   Nitrosomonas sp. AL212: NAL212_1488Help
Entry
NAL212_1488       CDS       T01443                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
nit  Nitrosomonas sp. AL212
Pathway
nit00521  Streptomycin biosynthesis
nit00523  Polyketide sugar unit biosynthesis
nit01130  Biosynthesis of antibiotics
Module
nit_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:nit00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    NAL212_1488
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NAL212_1488
Enzymes [BR:nit01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     NAL212_1488
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom Cupin_2
Motif
Other DBs
NCBI-ProteinID: ADZ26372
UniProt: F9ZIV4
Position
complement(1425048..1425560)
Genome map
AA seq 170 aa AA seqDB search
MLIKDAIKDQQTVTSEGESTNTLLAGVKKHEVPNIITSNGITTELYRPEWDIGPEQIRHM
IHAILRPGAISAWHMHEFQIDTIFVINGAIKLVLYDDRADSATKGQLNVFHMSRLRPTLI
TIPSGIWHGLQNLDYSESSFINYFNNPYVYSGPDEWRLPADTDKIPYQFK
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgctaataaaagacgcaatcaaagatcaacagacggtaacttcagagggggaatctaca
aacaccctactggcaggagtaaaaaaacacgaagtacccaatatcatcacatccaatggt
atcaccacggagctttaccgcccggaatgggatattggtccggaacagatacggcatatg
attcatgccatactacgccccggcgccatcagcgcgtggcatatgcatgaatttcaaata
gatacgatatttgtgatcaacggagcgataaaactggttctgtatgatgatcgcgctgat
tcagcgacaaagggacaactcaacgtctttcacatgagtcgcttgagacctacgttgatc
actattccttctggtatctggcatggtttgcaaaatttggattattctgaaagtagcttt
attaactactttaataacccttatgtttattctggtccggacgaatggcgattgcccgct
gataccgacaaaattccttatcaattcaagtaa

DBGET integrated database retrieval system