KEGG   Nitrosomonas sp. AL212: NAL212_2884Help
Entry
NAL212_2884       CDS       T01443                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
nit  Nitrosomonas sp. AL212
Pathway
nit00010  Glycolysis / Gluconeogenesis
nit00260  Glycine, serine and threonine metabolism
nit00680  Methane metabolism
nit01100  Metabolic pathways
nit01110  Biosynthesis of secondary metabolites
nit01120  Microbial metabolism in diverse environments
nit01130  Biosynthesis of antibiotics
nit01200  Carbon metabolism
nit01230  Biosynthesis of amino acids
Module
nit_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:nit00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NAL212_2884
  Energy metabolism
   00680 Methane metabolism
    NAL212_2884
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NAL212_2884
Enzymes [BR:nit01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     NAL212_2884
Membrane trafficking [BR:nit04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    NAL212_2884
Exosome [BR:nit04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   NAL212_2884
  Exosomal proteins of melanoma cells
   NAL212_2884
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 Glyco_trans_4_4
Motif
Other DBs
NCBI-ProteinID: ADZ27670
UniProt: F9ZK10
Position
2868508..2869248
Genome map
AA seq 246 aa AA seqDB search
MPEAIPLQKTSRQNMTKLVLLRHGQSIWNRDKKFTGWSDVALSPKGEQEAEQAAYLLKRA
GFTFDVCFTSVLQRATSTSRIVLAAMHLDIPVLQTWHLNERHYGALEGMGRWPAIKQFGI
WPILGCQIKFDAAPPSLNKGDYRYPGNQSDYASIDRNELPTGESLQQTLVRLKPYWQDTI
QPEIRQGKHVLIVSHRNTLRALMMLLDHLTPAQVMKLKLATGRPVVYELDQQCNASRHYY
VDKLVG
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgccagaagctatcccattgcaaaaaacttctcggcaaaacatgacaaagctggtactg
ctgcgtcatggacaaagtatctggaatcgtgacaaaaaattcaccggctggagcgatgta
gcactgagcccaaaaggtgaacaggaagctgaacaagcggcctacttgctgaaacgcgca
ggctttacatttgatgtgtgttttacttccgtattacaacgcgccacatcaacttcacgc
attgtcctggcggctatgcacctggatattccggtgctgcaaacctggcatttaaacgag
cggcattatggggcactggaaggcatgggacgttggccggcgatcaagcaattcggcatt
tggccgattctgggctgtcaaatcaaatttgacgccgccccccccagcctgaataaagga
gattaccgttatcccggtaatcaatccgattatgcctctattgatcgcaatgaactgcca
acgggggagagtttgcaacaaacccttgtgcgcctcaaaccttattggcaggatacgatt
caaccggaaatccggcaaggaaaacacgtgctgatcgtctctcatcgcaacaccctgcgc
gcattgatgatgctgctggatcatcttacacccgcacaagtcatgaagttgaaactggct
accggtcgacccgtggtgtatgaactggatcaacaatgcaatgcctcgcggcattattac
gtcgacaagctggttggatag

DBGET integrated database retrieval system